KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3A12.13cHelp
Entry
SPAC3A12.13c      CDS       T00076                                 

Definition
translation initiation factor eIF3j (p35)
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPAC3A12.13c
Translation factors [BR:spo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SPAC3A12.13c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(1442261..1443072,1443116..1443128))
Genome map
AA seq 274 aa AA seqDB search
MDSWEDFLVEDPAKPAEFDFPLGKDSQSSSKPKKRFDDEEDEDEEENKESLQNDSHSVSQ
KSSSSSQNDQGSNKMTRIQQKIQERNFEKAIKASEAAAKEESLESSKEAMRQAEIDSDLA
NAMDLFDIVDKNSASANRSKQADQRQLKTKADYAAFQADILKKVKNCQTTAEYNNFVQDL
IPLLLTGLNATNLKAVQKSVNKLVVNKEQQEKTQSKRGAAAPAAKPVSTAAPSKKGGKPT
VNVNSKKTVADKSAYEDYIEDEYDDYADDFDDFM
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggatagctgggaggactttttagtagaagatcctgcaaagcctgcagagtttgatttc
cccttagggaaggatagtcaatcctcttccaagccaaaaaagagatttgacgacgaagag
gatgaagatgaagaagaaaacaaagaatccttgcaaaatgattctcattcagtatcccaa
aaatcctcttcatctagccaaaatgatcaaggctctaacaaaatgactcgtatccaacaa
aaaattcaggaaagaaatttcgaaaaagccattaaagcaagtgaagcagctgcgaaggaa
gaatcactagaaagttccaaagaagctatgcgacaagccgaaattgactctgacttggca
aatgccatggacttgtttgacatcgttgataaaaactcagcaagtgcaaaccgctccaag
caagctgatcaacgacaactcaaaacaaaagccgactatgcagctttccaagctgatatt
ttgaagaaggttaaaaattgtcaaaccactgccgagtataataattttgtgcaagattta
atccctttattgcttaccggccttaatgctaccaatttgaaggcagttcagaaatcagtg
aataaacttgtagtcaacaaagagcagcaagaaaaaactcaatctaagagaggtgccgct
gctcctgctgccaaaccagtatcaactgcagctccttctaagaaaggaggaaaacctacg
gtcaatgttaattctaaaaaaaccgttgctgacaagtccgcttacgaagattacattgag
gatgagtatgatgactatgcggatgactttgatgacttcatgtaa

DBGET integrated database retrieval system