KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3G9.07cHelp
Entry
SPAC3G9.07c       CDS       T00076                                 

Gene name
hos2, hda1, phd1
Definition
histone deacetylase (class I) Hos2
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SPAC3G9.07c (hos2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:3170110..3171414
Genome map
AA seq 434 aa AA seqDB search
MDTPETSTPYEQVEKGSFFSFRPQKKRVTYHLDEQVGNYHYGDKHPMKPHRITITNHLVM
GYGLHNKMSVFSPRMATFGEMSEFHREDYLDFLKRVTPDNAEQFADKFQQFNIGDDCPVF
DGTYEFSQRSAGASLDASRKLVQGQTDIAINWSGGLHHAKRGEASGFCYVNDIVLAILNM
LRFFPRVLYIDIDIHHGDGVQQAFYESDRVLTVSFHKYNGDFFPATGNFDENGVKGGKYF
ALNVPLEDGIGDEQYTSLFKSIIEPTINTFQPSAIVLQCGADSLGYDRLGVFNLSIHAHG
ECVRFTRSFNIPMLVVGGGGYTLRNVARAWCYETSICVNEQIPSELPRETLYYEFFAPDY
TLHPRLTTKIENKNTPKALEDLRIRALEQLRYLGGAPSVQMQQIPPDLTGHLEEEDERLN
DEYLDKAVDVRVRG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggatactcctgagacatccacaccttatgaacaagttgaaaaggggtctttttttagc
tttcgacctcaaaaaaagcgtgtcacatatcacttagatgaacaggtgggaaactaccac
tatggtgacaaacatccaatgaagccccatcgaattaccattacaaatcatttagtgatg
ggttatgggttgcataacaaaatgagtgtattcagcccccggatggcaacttttggtgaa
atgtcagaatttcatagggaggattatttggatttccttaagcgcgttactcctgataat
gctgaacaatttgctgataagttccaacaattcaatattggtgatgactgtccggtcttt
gacggcacttatgaattttctcaaaggtcggcaggcgctagtttggatgcttctcggaag
ttagtgcaaggtcaaacagacattgctatcaattggagcggtggtctccatcatgcaaag
cgtggtgaggctagtggattctgctatgttaatgatattgttctagcaattttgaacatg
ctacggttttttcctcgcgttttgtatatcgatatcgatattcatcatggagatggtgtg
cagcaagcattctatgaatctgaccgcgtgttgacggtttcttttcacaagtataatggt
gatttttttcctgcaactggtaattttgatgaaaatggcgtgaaaggagggaaatatttt
gctttaaacgttcctttggaagatggtattggtgatgaacagtacactagtcttttcaaa
tccataattgaaccaactatcaatacttttcaaccttctgcaattgtccttcagtgtggt
gctgattcgcttggttatgatcggctcggcgtgttcaatctgagcatccatgcacatggg
gaatgtgttagatttacccgttcattcaatatacccatgcttgtagttggaggtggtggt
tatactcttagaaatgttgctagagcgtggtgttatgaaacttccatatgtgtaaacgaa
caaataccttcagaattacctcgtgaaactttgtattacgaatttttcgcaccagattac
accctccatccgcgattaaccacgaagatagaaaataaaaatacaccgaaagctcttgaa
gatcttcgaatacgggccttggagcaattacgttacttaggaggagcgccaagcgttcag
atgcagcaaattccaccagacttaactgggcatttggaagaagaagacgaacggttgaat
gatgaatacttagacaaagctgtggatgttcgcgttcgaggctga

DBGET integrated database retrieval system