KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3H1.07Help
Entry
SPAC3H1.07        CDS       T00076                                 

Gene name
aru1, car3
Definition
arginase Aru1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:1944231..1945202
Genome map
AA seq 323 aa AA seqDB search
MSPHKISDNHRHLMLSRFMMGNGVSIINMPFSGGQPKDGAELAPEMVEKAGLVDDLEHLG
YDVKLIQNPEFKSRPSKEGPNQALMKNPLYVSNVTRQVRDAVQRELEQQRVVVNIGGDHS
LAIGTVEGVQAVYDDACVLWIDAHADINTPESSPSKNLHGCPLSFSLGYAEPLPEEFAWT
KRVIEERRLAFIGLRDLDPMERAFLRERNIAAYTMHHVDKYGIGRVVEMAMEHINPGKRR
PVHLSFDVDACDPIVAPATGTRVPGGLTFREAMYICEAVAESGTLVAVDVMEVNPLLGNE
EEAKTTVDLARSIVRTSLGQTLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctcataaaattagtgataaccaccgtcatttgatgttaagtagatttatgatg
ggaaatggtgtttccatcataaacatgcctttctctggtggccagcccaaggacggtgca
gagttggctcccgaaatggttgaaaaggctggccttgtggatgatttggaacaccttgga
tacgatgtcaagctcatccaaaaccccgaatttaaaagtcgtccttccaaggagggtccc
aaccaggctttaatgaaaaaccctttatacgttagcaatgttactcgtcaagttcgtgat
gctgtccaacgtgaattagaacagcaaagagttgttgtcaacattggcggtgatcattct
cttgccattggtactgtggagggtgtgcaggccgtttatgatgatgcctgtgtcttgtgg
attgacgctcacgctgacattaacactcctgaatcttctccttctaaaaatcttcatggt
tgccccttgtcattttctttaggatacgccgagcctctccctgaagagtttgcttggacc
aagagagttattgaagagcgtcgtctggcttttattggattgcgtgatttagatcctatg
gagcgcgcttttcttcgtgagcgtaacatagccgcttataccatgcaccacgtcgacaaa
tacggaattggccgtgtcgttgagatggcgatggagcacatcaatcctggtaagagacga
cctgtccatctttccttcgatgttgacgcttgcgatcccatcgttgccccagccactggt
acccgtgttccaggcggtttgactttccgtgaggcaatgtacatctgcgaagctgtagct
gaatccggtacattggttgctgttgatgttatggaggttaatccactacttggtaatgaa
gaggaggccaagactacggtggacttggcccgctctatcgttcgtactagtcttggtcaa
actttactttaa

DBGET integrated database retrieval system