KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4A8.07cHelp
Entry
SPAC4A8.07c       CDS       T00076                                 

Definition
sphingoid long chain base kinase (predicted) (EC:2.7.1.107)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPAC4A8.07c
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SPAC4A8.07c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(2556773..2557848,2557938..2558123,2558183..2558297))
Genome map
AA seq 458 aa AA seqDB search
MDFGLTNNSIKAFEDQKLLHIHQSCVSYPSDTLICSIPVSAKNVDLNIPFKNILWVDKTG
PNSVTLSYVSRSSKVATKCWVDFVENSDQFCEYLLDVAYKGIKRSRRFIVFINPHGGKGK
AKHIWESEAEPVFSSAHSICEVVLTRRKDHAKSIAKNLDVGSYDGILSVGGDGLFHEVIN
GLGERDDYLEAFKLPVCMIPGGSGNAFSYNATGQLKPALTALEILKGRPTSFDLMTFEQK
GKKAYSFLTANYGIIADCDIGTENWRFMGENRAYLGFFLRLFQKPDWKCSIEMDVVSSDR
TEIKHMYEKSKNLAPMSESSDSDKTVSTSPESHLLTFEINDLSIFCAGLLPYIAPDAKMF
PAASNDDGLIDVVIVYSKQFRKSLLSMFTQLDNGGFYYSKHLNYYKVRSFRFTPVNTGKR
HYFALDGESYPLEPFECRVAPKLGTTLSPVAGFQLLDI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggatttcggtcttaccaataattcaatcaaagcttttgaagatcagaaacttttgcac
attcatcaatcttgtgtctcttaccctagcgatactttgatctgttctattccagtctct
gcaaaaaatgtcgatttaaacattccttttaaaaacattctttgggtagataaaactggc
cctaattctgtaacgttaagttatgtatctagatcaagcaaagttgcaacaaaatgctgg
gttgatttcgtcgaaaattccgatcagttttgtgaatatttgttggacgttgcatataaa
ggtataaaacgttcaagacgattcattgtttttattaatccccatggagggaagggaaaa
gccaaacatatttgggaaagtgaagcggaaccagttttcagtagtgctcacagtatatgt
gaagtagttttgactagacggaaggatcatgcaaaaagtattgcaaagaatcttgacgtc
ggaagttatgacggtatattatctgttggaggtgatggcttgtttcatgaagtgatcaat
ggcttgggtgagagagacgattacttggaagcattcaaacttcccgtttgtatgatacct
ggtggatctggtaatgcatttagttataatgcgacaggacaacttaaaccagcattaacc
gctttggaaattcttaaaggaagacctacttctttcgatttaatgacctttgaacaaaaa
ggaaagaaggcttactcttttttgacagccaattatggtatcatcgctgactgcgatatt
ggtactgagaattggagatttatgggtgaaaatcgtgcatatcttgggttctttttgcgt
ctttttcaaaaaccggattggaaatgtagcattgaaatggacgttgtgtcttctgatcgt
acagaaattaaacacatgtatgagaaaagtaaaaacttagcaccgatgtctgaatcaagc
gatagcgataaaacggtttcgacgagtcctgaatcacatttattgacctttgaaatcaat
gatctttcaatcttttgtgctgggttacttccgtatatcgcacctgatgcaaaaatgttc
cctgcagctagcaacgatgacggcttaatcgatgttgtaattgtttattctaaacaattt
cgtaaatctttattgagtatgtttactcaactcgataatggaggtttttattactctaag
catttaaactattacaaagttcgttcttttcgatttactcctgttaatacgggaaagcgt
cattattttgctttagatggtgaaagttacccattggaaccatttgaatgtcgcgtggct
ccaaaattaggaactactttatctcctgttgcagggtttcaattgttggatatataa

DBGET integrated database retrieval system