KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4A8.15cHelp
Entry
SPAC4A8.15c       CDS       T00076                                 

Gene name
cdc3
Definition
profilin
Orthology
K05759  
profilin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(join(2578990..2579027,2579084..2579416,2579466..2579478))
Genome map
AA seq 127 aa AA seqDB search
MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGT
GIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALAD
YLVGVGY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacgttgatacttctttgctcggtactggaaaaatcgatcgcgct
gctatcgtctctcgtgctggtgacagtgtttgggctgcttctgctggattcaatctttct
cctcaggaaatccaaggccttgccgctggtttccaagatccacctagtatgtttggcact
ggtatcattttagccggtcaaaaatacatcactattcgagctgaaggacgttctatctat
ggtaaattacagaaagagggcattatttgtgtagctactaagctttgcattttggtttct
cactaccctgaaacaacccttccaggagaagccgccaagattactgaggctttagctgat
tatcttgttggtgttgggtattag

DBGET integrated database retrieval system