KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4A8.15cHelp
Entry
SPAC4A8.15c       CDS       T00076                                 

Gene name
cdc3
Definition
(RefSeq) profilin
  KO
K05759  
profilin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Membrane trafficking [BR:spo04131]
 Others
  Actin-binding proteins
   Others
    SPAC4A8.15c (cdc3)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     SPAC4A8.15c (cdc3)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPAC4A8.15c (cdc3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(join(2578990..2579027,2579084..2579416,2579466..2579478))
Genome map
AA seq 127 aa AA seqDB search
MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGT
GIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALAD
YLVGVGY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacgttgatacttctttgctcggtactggaaaaatcgatcgcgct
gctatcgtctctcgtgctggtgacagtgtttgggctgcttctgctggattcaatctttct
cctcaggaaatccaaggccttgccgctggtttccaagatccacctagtatgtttggcact
ggtatcattttagccggtcaaaaatacatcactattcgagctgaaggacgttctatctat
ggtaaattacagaaagagggcattatttgtgtagctactaagctttgcattttggtttct
cactaccctgaaacaacccttccaggagaagccgccaagattactgaggctttagctgat
tatcttgttggtgttgggtattag

DBGET integrated database retrieval system