KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4C5.04Help
Entry
SPAC4C5.04        CDS       T00076                                 

Gene name
rad31, uba4
Definition
SUMO E1-like activator enzyme Rad31
Orthology
K10684  
ubiquitin-like 1-activating enzyme E1 A [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(1198459..1198541,1198592..1199020,1199074..1199219,1199298..1199397,1199454..1199619)
Genome map
AA seq 307 aa AA seqDB search
MGNHNINAEEIALYDRQIRLWGFNAQQALKQSRVLLITASPLANEIAKNLVLSGIGKLCV
LDSMTVYEKDVEEQFFIEASDIGQLRANVFKKKLHELNPLVEIDTDTSLISEIDEGKISK
FSMVIATQLDYEEFCRINELTRICNASFYATSCFGLYGFAFCDLINHNFAIDRVVDNTKV
EEDMFIVQKPMKEAFQSILGETLKPRLAKKIPTLYPAMLSLLKSKKSDPDSIRQVCIEQK
LNEKTVLNGEFLSKFSSNISFQWTPVMSVVGGVVSQDALNSISKKQFPIDNFWIFDAESG
LAPIYRL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggggaatcacaatattaatgctgaagaaatagctttatacgatagacagattaggctc
tggggctttaatgctcaacaagcactaaagcaatcccgcgtcctattaataactgcttct
ccattagcgaatgaaatagcgaaaaacctggtattatctggaataggaaaactttgtgta
ttagattcaatgactgtttatgaaaaggatgtcgaggagcaattttttatagaagcttca
gacattggccagctccgcgctaatgtcttcaagaaaaagttacatgaattaaacccttta
gtagaaattgatacagatacgtctctgatatctgaaattgacgaaggaaaaatctcaaag
ttcagcatggttattgcgacgcaacttgattatgaagagttctgccgaataaacgaatta
acccgaatttgtaatgccagtttctacgcaactagctgttttggtctttatgggttcgct
ttttgtgatttgattaaccacaattttgcaattgatcgagtcgttgataatactaaagta
gaagaggatatgtttattgttcaaaaacccatgaaggaagcctttcaaagcatattgggc
gaaacactaaaacccaggttagcaaaaaagattcctacattatatccagcgatgttatct
ttattaaaaagtaaaaaatcagatcctgactcgattcgacaagtttgcatcgagcaaaag
ctgaacgagaaaacagtactaaatggagaatttttatcaaaattttcttccaatatcagc
tttcaatggactccggttatgtccgttgttggcggggttgtttcacaagatgcattgaat
tcaattagcaagaagcagttccccattgataatttctggatttttgatgccgaatcaggc
cttgctccaatttatcgtttgtaa

DBGET integrated database retrieval system