KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4D7.03Help
Entry
SPAC4D7.03        CDS       T00076                                 

Gene name
pop2, sud1
Definition
F-box/WD repeat protein Pop2
Orthology
K03361  
F-box and WD-40 domain protein CDC4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-CDC4 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:5355131..5357242
Genome map
AA seq 703 aa AA seqDB search
MSLSRCPTDNSSSRINSSVPLINSSSPATPPESFDPQVFPSSLIHGDNLLPQDDQIASDP
RSESNSCNGNTSSSLPCTDSYQYPLKHSCTPSFLRKFNESIENVSYKCLDHSPPDSVPGD
FSISLVPQRNFLYSHSSLPPKIISIDRNNRIKLDNSISSNSDNFPPSPKVDTSNTVSPGS
KPISEDLEDLNLQSIVQTFEDLPEGIQSYAFFQLLRSCNRQSMRLLLNECEPLLKKDILS
NLPFSIVQSILLNLDIHSFLSCRLVSPTWNRILDVHTSYWKHMFSLFGFQINENDWKYAN
PNLNRPPFLHNDQISDDYFPEIFKRHFLNRKRWLFPSIPPSHLSFPIHVPNFMITSLLLH
KDRIITTSGSGTIQIHNAITGVLEARLEGHKEGVWAVKIHENTLVSGSIDKTVRVWNIEK
AKCTHIFRGHISIIRCLEILVPSRLIRHGVEIVEPDQPYIVSGSRDHTLRVWKLPKNTDP
PYLPDNTNSIDRWEKNPYFVHTLIGHTDSVRTISGYGDILVSGSYDSSIRIWRVSTGECL
YHLRGHSLRIYSVLYEPERNICISGSMDKSIRVWDLSTGTCKYVLEGHDAFVTLLNVFQN
RLISGSADSTIRIWDLNTGKPLMVLPSNSGYISSFVSDEHKIISGNDGSVKLWDVRTGKL
LRFLLTDLTKIWHVDFDAMRCVAAVQRDDQAYLEVINFSGSRP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctctaggtgtccaactgacaattcgtcctcccgtataaattcctctgttcct
ttaataaatagcagcagccctgctacacctccagaatcatttgatcctcaagtatttcct
tcttcacttattcatggggataacctgcttcctcaagatgatcaaattgcatcggatcct
cgctcagaatcaaatagttgtaatggcaatacgagttcttccctgccgtgcactgattcg
tatcagtacccattaaagcattcttgtacgccttcttttcttcgaaagtttaatgaaagt
atagagaatgtctcttataaatgcttagaccactcaccgccagatagtgttcctggcgat
ttttccatttcccttgttcctcaaaggaattttctatattctcattcttctcttccacct
aaaattatatcaattgatagaaacaatcgaattaagttagataatagcatttcatctaac
tccgacaatttccctccttctccgaaagtcgacacatcaaacactgtttcacctggtagt
aaacctatctctgaggatcttgaagatttaaacttacagtcaattgttcaaacttttgag
gatcttccagaaggaattcaatcttatgcgttttttcaactactccgttcgtgcaatcgg
caatcgatgcgtttattattgaatgaatgcgagccgcttctaaaaaaagatatactttca
aatcttcctttttccattgttcagtctatattattaaatctggatatacattcttttctt
tcttgccgtcttgtttcgcctacttggaatagaatacttgatgtgcatacttcatactgg
aaacacatgtttagtttatttggctttcaaatcaatgaaaatgactggaaatatgctaat
ccaaacttaaatcgtccaccttttttgcacaacgaccaaatctcagatgactattttccg
gaaattttcaaaagacattttctcaatagaaaacgatggttatttccttcgatacctcca
agtcatctatcttttcccattcatgttccaaactttatgataacttctttactacttcat
aaagacagaataatcaccacttcgggatctggaacaattcaaattcataatgctattacc
ggtgttttagaagctcgattagagggtcataaagaaggtgtttgggctgtcaaaatacat
gagaatacacttgtatctggttcgatcgataaaactgttcgcgtttggaacatagagaaa
gctaaatgtacgcacatatttaggggacatatttccatcatcagatgcttagagatctta
gttccgagtcgtcttattcgccatggagttgaaattgttgaaccagatcaaccgtacatt
gtcagcggctctcgggatcatacacttcgggtttggaagcttccaaaaaacacggatcct
ccttatcttccagataatacaaactctattgaccgttgggagaagaacccgtattttgta
catactttgataggacatacagactctgtacgaactatatccggctatggtgatatactt
gtgagtgggagttatgattcttcaattcgcatttggagagtttcaacaggggaatgtctt
taccatctgcggggtcatagtcttcgtatatatagtgttttatatgaaccagaaaggaat
atttgcataagcggtagcatggataagtccattagggtttgggatttatcgacagggact
tgtaaatatgtgcttgaaggccatgatgcctttgttacgcttcttaatgtattccagaat
aggttgatatcaggttctgctgactccacaattagaatatgggatttgaatactgggaaa
ccattaatggttttgccgtctaattcaggctacattagtagctttgtgtcagatgaacac
aaaattattagtggtaatgatggttctgtaaagttatgggatgttaggactggaaagctg
ttacgttttctattaacagacctcacaaaaatatggcatgtcgattttgatgctatgcgt
tgtgtggctgcagtgcagcgtgatgatcaagcatatttggaagttattaatttttccgga
tcaagaccgtag

DBGET integrated database retrieval system