KEGG   Schizosaccharomyces pombe (fission yeast): SPAC56E4.04cHelp
Entry
SPAC56E4.04c      CDS       T00076                                 

Gene name
cut6
Definition
acetyl-CoA/biotin carboxylase (EC:6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SPAC56E4.04c (cut6)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPAC56E4.04c (cut6)
   00640 Propanoate metabolism
    SPAC56E4.04c (cut6)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SPAC56E4.04c (cut6)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SPAC56E4.04c (cut6)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SPAC56E4.04c (cut6)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SPAC56E4.04c (cut6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(1246095..1252807,1253430..1253559))
Genome map
AA seq 2280 aa AA seqDB search
MRQSVTSSSSCSKLYAIKATISLPRLFYRRLRTMAPRVASHFLGGNSLDKAPAGKVKDYI
ASHGGHTVITSILIANNGIAAVKEIRSIRKWAYETFNNERAIKFTVMATPDDLKVNADYI
RMADQYVEVPGGSNNNNYANVELIVDIAERMNVHAVWAGWGHASENPKLPEMLSASSKKI
VFIGPPGSAMRSLGDKISSTIVAQSARVPCMSWSGNELDQVRIDEETNIVTVDDDVYQKA
CIRSAEEGIAVAEKIGYPVMIKASEGGGGKGIRQVTSTEKFAQAFQQVLDELPGSPVFVM
KLAGQARHLEVQILADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAPAATFHEMERAAV
RLGELVGYASAGTIEYLYEPENDRFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQVAMGL
PLSRIPHIRELYGLPRDGDSEIDFFFQNPESFKVQKVPTPKGHCVACRITSEDPGEGFKP
SSGMIKDLNFRSSSNVWGYFSVGTAGGIHEFADSQFGHIFSFAESRESSRKSMVVALKEL
SIRGDFRTTVEYLVRLLETKEFSENEFTTGWLDRLIAQKVTSARPDKMLAVVCGALVRAH
ATADTQYRAFKSYLERGQVPSREFLKNVYDIEFIYDNTRYRFTASRSSPGSYHLFLNGSR
CTAGVRSLTDGGLLVLLNGHSYTVYYRDEVTGTRISIDNLSCMLEQENDPTQLRTPSPGK
LVRFLVETGEHIKAGEAYAEVEVMKMIMPLVATEDGVVQLIKQPGASLDAGDILGILTLD
DPSRVTHALPFDGQLPNWGEPQIAGNKPCQRYHALLCILLDILKGYDNQIILNSTYNEFV
EVLRNHELPYSEWSAHYSALVNRISPVLDKLFVSIIEKARSRKAEFPAKQLEVAIQTYCD
GQNLATTQQLKVQIAPLLKIISDYKDGLKVHEYNVIKGLLEEYYNVEKLFSGINKREEDV
ILRLRDENKDDVDKVIALALSHSRIGSKNNLLITILDLMKSEPSTFVSLYFNDILRKLTD
LDSRVTSKVSLKARELLITCAMPSLNERFSQMEHILKSSVVESHYGDAKFSHRTPSLDIL
KELIDSKYTVFDVLPAFFCHTDPWVSLAALEVYVRRAYRAYSVLEINYHTEAGTPYVLTW
RFQLHSSGAPGLGANSTNGSNFPASTTPSYENSNRRLQSVSDLSWYVNKTDSEPFRFGTM
IAAETFDELENNLALAIDRLPLSRNYFNAGLTLDGNSSSANDNTQELTNVVNVALTSTGD
LDDSAIVSKLNQILSDFRDDLLEHNVRRVTIVGGRINKSAYPSYYTYRVSAEQKDGNLVH
YNEDERIRHIEPALAFQLELGRLSNFNIEPVFTDNHNIHVYRATAKNMDTDKRFFTRALV
RPGRLRDEIPTAEYLISETHRLINDILDALEVIGHEQTDLNHIFINFTPAFGLAPKQVEA
ALGGFLERFGRRLWRLRVTAAEIRIICTDPSTNTLFPLRVIISNVSGFVVNVEIYAEVKT
ENNSWIFKSIGQPGSMHLRPISTPYPTKEWLQPRRYKAQLMGTTFVYDFPELFRRAFTDS
WKKVPNGRSKVTIPQNMFECKELVADEHGVLQEVNREPGTNSCGMVAWCITVKTPEYPNG
RKIIVVANDITFQIGSFGPQEDEYFYKVTQLARQRGIPRIYLAANSGARIGVADEIVPLF
NIAWVDPDSPEKGFDYIYLTPEAYERLQKENPNILTTEEVVTETGELRHKITTIIGSSEG
LGVECLRGSGLIAGVTSRAYNDIFTCTLVTCRAVGIGAYLVRLGQRAVQIEGQPIILTGA
PALNKVLGREVYTSNLQLGGTQVMHRNGISHLTSQDDFDGISKIVNWISYIPDKRNNPVP
ISPSSDTWDRDVEFYPSQNGYDPRWLIAGKEDEDSFLYGLFDKGSFQETLNGWAKTVVVG
RARMGGIPTGVIAVETRTIENTVPADPANPDSTEQVLMEAGQVWYPNSAFKTAQAINDFN
HGEQLPLFILANWRGFSGGQRDMFNEVLKYGSYIVDALASYKQPVFVYIPPFSELRGGSW
VVVDPTINEDQMEMYADEESRAGVLEPEGMVSIKFRREKLLSLMRRCDHKYASLCNELKR
DDLSADDLSTIKVKLMEREQKLMPIYQQISIHFADLHDRVGRMVAKKVVRKPLKWTEARR
FFYWRLRRRLNEHYALQKITQLIPSLTIRESREYLQKWYEEWCGKQDWDESDKSVVCWIE
EHNDDLSKRTQELKSTYYSERLSKLLRSDRKGMIDSLAQVLTELDENEKKELAGKLASVN
NT seq 6843 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagagcgttacctcttcctcttcctgtagcaagctctacgcgataaaagcaacc
atttcccttccacgactcttttaccgtagactgagaactatggctcctcgtgtagcctcc
cattttctgggaggcaattccttagataaagcacctgcaggaaaggtgaaagattatatt
gcatcacacggaggacacactgttatcacgtctattcttattgctaataatggtattgcg
gccgtgaaagaaatccgaagcattcggaaatgggcttatgaaaccttcaataatgaaaga
gctatcaagtttactgttatggcaacgccagatgatttaaaagttaatgccgattatatt
cgtatggccgatcagtatgtcgaagtacctggcggctcaaataacaataattatgctaat
gtcgaacttatcgttgacattgctgaacgtatgaacgtccatgctgtttgggctggttgg
ggacacgcatctgaaaaccctaaattgcctgagatgctttctgccagtagtaagaaaatc
gtttttattggtcctccaggtagcgcaatgcgtagtcttggtgacaaaattagttctaca
atcgttgctcaaagtgctcgtgtaccttgtatgtcttggtccggtaatgaactcgaccaa
gtacgtattgatgaagagacaaacattgttactgttgacgatgatgtttatcaaaaagcc
tgtattcgctctgcagaagaaggtattgccgtcgccgagaagattggttatcccgtcatg
attaaggcctctgaaggcggtggtggtaaaggtattcgtcaggttacttcaaccgaaaag
tttgctcaagcattccaacaagtacttgatgaactccctggatctcccgtttttgttatg
aaacttgctggacaagcacgccatttggaagttcaaattttagctgatcaatatggtaat
aatatttctctttttggtcgtgattgttccgttcaacgccgtcatcaaaaaattattgag
gaggctcctgttaccatcgcacctgccgctaccttccatgaaatggagcgtgccgccgtg
cgtttaggtgaattggtcggttacgcttctgctggtaccattgagtatctttatgagcca
gagaatgacaggttctatttccttgaactgaaccctcgtttacaggtcgagcatccaact
accgaaatggtttctggcgttaatttacccgctgcacaacttcaagttgctatgggtttg
cctcttagtcgtattccacacattcgtgagctctatggcttaccacgtgatggtgactct
gaaatcgattttttctttcaaaatcccgaatcttttaaagtacagaaggtccctactcct
aaaggccattgtgttgcctgtcgtattacgtctgaagatcccggcgaaggatttaaacca
tcgagcggtatgattaaagatctcaactttcgttcttctagcaatgtgtggggttatttc
tctgttggtactgctggtggaattcatgagtttgcggattcccaattcggtcatattttt
tcatttgcagaatctcgtgaatcctctcgcaaatcgatggtggttgcgttaaaagaatta
tctattcgtggtgattttagaactactgtcgaatatctcgtgcgtctccttgaaactaag
gagttttctgaaaatgagtttaccacaggatggctagatcggcttattgcacaaaaagtt
acatctgctcgtcccgacaagatgcttgctgttgtatgtggtgctcttgtccgtgctcat
gctactgccgatactcagtaccgtgctttcaaatcctaccttgaacgcggtcaagtaccg
tcccgtgaatttttgaaaaatgtgtatgatattgaatttatttatgataacactcgctat
cgttttaccgcatctcgttcttctccaggctcttatcatttgtttttaaatggttctcgt
tgtactgctggtgtccgttctttgactgatggtggattgttagttttgctaaacggacat
tcctatacagtatactatcgtgatgaggtaactggtactcgtatatctatcgataacctt
tcttgtatgctggaacaagaaaatgatcctactcaattaagaactccttcccctggcaag
ttggttcgtttcttggttgaaacaggtgagcatattaaagccggtgaagcgtatgcagag
gtagaagttatgaaaatgattatgcctttagtagcaaccgaagatggtgttgttcaattg
ataaagcaacccggtgcatctttagacgccggtgatattcttggaatactcacgcttgat
gatcctagccgtgtcacccatgcattaccatttgatggtcagcttcctaattggggtgag
cctcaaattgcgggaaataagccttgtcaacgctatcatgctcttttgtgtattcttttg
gacattctaaagggatatgataaccaaatcattctcaacagtacctacaatgaatttgtt
gaagtccttcgtaatcatgaattgccctatagcgaatggagtgctcattattcagcattg
gttaatagaatctctcctgtacttgataagctttttgtatctataatcgaaaaagccaga
tctcgtaaagctgaatttcctgccaaacagcttgaggttgctattcagacttattgtgat
ggtcaaaatttggcgacgactcaacaattaaaggtccaaattgcacctctccttaaaatc
atatctgactacaaagacggcctcaaagttcatgaatacaatgttattaaaggtttgctc
gaagaatattataatgttgaaaagttgttctctggaattaataagcgagaagaagatgtt
attcttcgtctacgtgacgaaaataaagatgatgttgataaagttattgcgttggcttta
tctcattctcgtataggatctaagaataacttgttaattacaattcttgatctaatgaag
tccgaaccatcaacttttgtttctctgtactttaatgacattttgaggaagcttacagat
ttggattcaagggttacttctaaagtgtctctaaaggctcgtgagttgttaattacatgt
gctatgccttctcttaatgagcgattctctcaaatggagcacatattgaaatcgtctgta
gttgaaagtcattatggtgatgctaaattctcacaccgtacaccatctttagacattctg
aaagaattgattgattctaaatatacagtctttgatgttttacctgctttcttttgtcac
accgacccatgggtatctttagctgctcttgaggtatatgttagacgtgcttatcgtgcc
tactctgttcttgaaatcaactatcataccgaggccggaactccgtatgtactcacgtgg
cgttttcagcttcattcaagtggtgctccgggtttgggtgccaactcaactaatggttcc
aatttccctgcaagcactactccttcatacgaaaacagcaatcgacgcctgcagtctgtt
agtgatctttcttggtatgtcaataaaacagactctgagccattccgttttggtacaatg
attgccgcagaaactttcgatgaattggaaaataaccttgcccttgcaatcgaccgttta
ccactttctcgtaattactttaatgctggtttaacgttggatggcaattcttcttcagct
aacgataacactcaagaattaactaatgtagtgaacgttgcgttaacctcaactggtgat
ttggatgattctgctattgttagcaagcttaaccaaatccttagtgatttccgtgatgat
ttgcttgagcataatgttagaagagtgacaattgttggtggcagaattaacaagtctgct
tatccttcctactatacttatcgtgtttccgctgaacaaaaagacggcaatcttgtacac
tataacgaagatgagcgtattcgtcatattgaacctgcattggcattccaattagaattg
ggtcgtctatcgaacttcaatattgaacccgttttcaccgataatcataacattcatgtt
tatcgtgctaccgccaaaaatatggatacagataagcgattctttactcgtgcattagtt
agaccaggaagattacgtgacgagatacctactgctgagtatcttatatccgaaacccat
cgtttaattaatgatattttggatgctttggaagttatcggtcatgaacaaacagacttg
aatcatattttcattaactttacaccagcctttggtcttgctcctaagcaagttgaagct
gccctcggcggatttttggaacgttttggccgtcgtttatggcgcttgagagtaactgca
gctgaaattcgtattatttgcacggacccatcaactaacactttgtttcctcttcgtgtc
attatttctaatgtttctggatttgttgtgaacgttgaaatttatgctgaagtcaagact
gagaataattcttggatatttaagagtatcggacaacctggatccatgcatcttcgcccc
atcagtacaccttatcctaccaaagaatggcttcaacctcgtcgttacaaagctcaatta
atgggcactactttcgtttatgacttcccagaattattccgtcgcgccttcaccgatagc
tggaaaaaggttccaaatgggcgatccaaagttactataccccagaatatgtttgaatgt
aaggagcttgttgctgacgaacatggtgtattacaggaagtcaatagggagcctggaact
aactcctgtggtatggtagcatggtgcattactgttaagacgcctgaatatcctaatgga
cgaaaaattatcgtagtggctaacgacatcactttccaaattggttcttttgggccccaa
gaggatgaatacttttataaagttactcaattggcacgtcaacgcggtattcctcgtatt
tacctcgctgccaattccggtgcacgtattggagttgctgatgaaatcgtccctcttttc
aatattgcttgggtcgatcccgatagtccagaaaagggttttgattatatctatcttact
ccagaggcatatgagcgtcttcagaaagaaaatcccaatattctcaccactgaggaggtt
gttactgaaactggggaacttcgccataagattaccacaatcattggctcaagcgagggt
cttggtgttgaatgtttgcgtggatccggtctgattgctggtgtcacatctcgcgcatac
aatgacatttttacatgtactttggtcacttgtcgtgctgttggtattggcgcgtacttg
gttcgtctcggccaaagagctgtacaaatcgaaggccaaccaattattctaacaggtgca
cccgcccttaacaaggttttaggccgtgaggtctatacctccaacttgcaattaggtggt
actcaagttatgcatagaaatggtatatcccatcttactagtcaagatgattttgatggc
atttcgaaaattgtaaactggatttcctatatccccgataaacgtaacaatccagtacca
atttcaccatcatcagatacatgggatcgtgatgtggagttctatccttctcaaaatggt
tacgatcctcgttggttaattgccggaaaggaagatgaagattctttcttgtatggttta
tttgacaaaggatctttccaggaaactttgaatggctgggccaagactgttgttgttggt
cgtgctagaatgggcggaattcctactggtgtgattgctgtcgagactcgtactattgaa
aacactgtaccggctgatccagctaaccctgactctactgaacaagtattaatggaggct
ggtcaagtttggtatcccaactcagccttcaagactgctcaagcaatcaatgacttcaac
catggtgaacagttacctctttttattcttgctaattggcgtggattttctggtggtcaa
cgtgatatgtttaatgaggtactcaaatatggttcttatatcgtagatgctttggcttct
tataaacaacctgtatttgtatacattcctccattcagtgaacttagaggtggctcttgg
gttgtagtagatccaaccatcaatgaggatcaaatggaaatgtacgcagatgaagagagt
agagctggtgttttggaacctgaaggtatggtcagtattaaattcagacgtgaaaagttg
ctttctttgatgcgacgctgtgatcataaatatgcatcattgtgcaatgagcttaaaaga
gatgatttgagtgctgatgacctttcaactataaaggtcaagttgatggaacgcgaacag
aagcttatgccaatttatcaacaaattagtattcattttgccgacttgcatgatcgtgtt
ggtcgtatggttgcaaagaaggttgtccgtaaaccgttgaaatggacagaagctagacgt
ttcttttactggcgtctccgcagacgtttgaatgaacattatgctcttcaaaagattacc
cagctcattccttccttgactatccgtgaatctcgtgagtatctccagaaatggtatgaa
gagtggtgtggaaagcaagattgggatgaatctgataagtctgttgtttgttggattgag
gaacataacgacgatttgagtaagagaactcaggaacttaagagtacttattacagtgag
cgtctttctaaactccttcgttcagataggaagggaatgatagacagccttgcacaagtt
ttgaccgagctcgacgaaaatgaaaagaaagaattggccggaaaactcgcgtcggttaat
taa

DBGET integrated database retrieval system