KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A10.05cHelp
Entry
SPAC57A10.05c     CDS       T00076                                 

Gene name
pof1
Definition
F-box/WD repeat protein protein Pof1
Orthology
K10259  
F-box and WD-40 domain protein MET30
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-MET30 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(1373066..1374883)
Genome map
AA seq 605 aa AA seqDB search
MTTGYESVPTSEPSDNLAPRAELWQRHLLEKKEGDQSISVSAFNISSMHNELSGLSEKSR
QRVEAVWAAFSEASCSERKLALQGILNNCSSSLLSFASSTLDSLVRLDFLSLLPVEISFR
ILSFLDARSLCQAAQVSKHWKELADDDVIWHRMCEQHINRKCEKCGWGLPLLERNTLYAA
KASIQKRYERLTKRGVDQAHESSPVKKAKLDDYPTSSNEETISSVKPPSPNSDSKFFLPF
KTRPWKEVYAERCRVECNWRHGRCRQVVLSGHSDGVMCLQLVRNILASGSYDATIRLWNL
ATFQQVALLEGHSSGVTCLQFDQCKLISGSMDKTIRIWNYRTSECISILHGHTDSVLCLT
FDSTLLVSGSADCTVKLWHFSGGKRITLRGHTGPVNSVRIIRDRGLVLSGSDDSTIKIWS
LETNTCLHTFSAHIGPVQSLALADSRLFSCSLDGTIKQWDIEKKKCVHTLFGHIEGVWEI
AADHLRLISGAHDGVVKVWEACECVHTLKNHSEPVTSVALGDCEVVSGSEDGKIYLWLFN
NAPNESPVSTQSVPISSLNGQRSNSSVQRALSSVPNYSSSLSNISTRNLNIPPSNANNDD
VSIQS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgactacaggttatgaatctgttcccacttccgaaccctctgataatcttgcaccacga
gcagagctatggcaacgccatttactggaaaaaaaagaaggtgatcaatccatctccgtt
tcggcttttaatatttcttcaatgcataatgaattgtctggtttaagcgaaaaaagtcgt
caacgtgtcgaagctgtatgggctgctttttcagaggcttcttgcagcgaacgtaaactc
gctttgcaaggcattttaaacaactgttcgtcctctcttctctcttttgcctccagcaca
ttagattctctagtacgcttagattttctctctttgctccctgttgaaatttcgtttcgc
attttatcttttttggatgctagaagcctttgccaagctgcacaagtcagtaaacattgg
aaagaacttgctgatgatgatgttatatggcatcggatgtgtgaacaacatattaatcga
aaatgtgaaaaatgcggctggggacttccgttactcgaaagaaataccttatacgcagca
aaggcttccatacaaaaacgttatgaacgacttacaaaaagaggcgtcgatcaggctcat
gaatcttcacccgtcaaaaaagcaaagctggacgattatccgacgtcgagtaatgaagag
actatttcttctgtcaaaccaccttctccgaactccgattccaaattctttcttcccttt
aaaaccagaccatggaaagaagtatatgctgaacgttgtagagttgaatgcaactggcgg
catggtcgttgtcgccaggttgttctcagtggccactctgacggtgttatgtgtctacaa
cttgtaaggaacattcttgctagcggcagttatgatgccactatacgattatggaatctt
gctacctttcaacaagttgctctattagaaggtcatagcagtggtgttacgtgccttcaa
ttcgatcagtgtaaacttatcagcggttcaatggacaaaactattcgtatatggaactac
agaacctctgaatgcatttctattttacatggtcatacggatagtgttttatgcttaacg
tttgactctacgctacttgtttctggaagcgcagattgtacagttaagctgtggcacttt
tctggcggtaagcgtatcactttacgcggtcacacaggacctgtcaattctgtccgcata
attagagatcgtggacttgttctttccggttccgacgattccaccatcaagatttggtct
ttggaaacaaacacgtgtcttcatactttcagtgctcatattggccctgtccagagttta
gctcttgctgattcgcgattgttttcttgctcattggacggcacaataaagcaatgggac
atcgagaagaaaaaatgtgttcatacattgtttggacacattgaaggtgtatgggaaatt
gcggcagatcaccttcgtttaatctcgggagctcatgatggtgttgttaaagtttgggag
gcttgtgaatgtgttcacacgttgaagaatcactcggagcctgtaacctcggttgctctt
ggagactgtgaggtagtcagtgggtctgaagatgggaaaatatatttgtggcttttcaat
aatgctccaaatgaatctccagtatctacacaatctgttccgatatcttcccttaatggt
caaaggtcaaattcaagtgtgcaacgagctctttcttcagtacccaactactcatcctcg
ttatccaatatctcaaccagaaatttaaatatcccaccctctaatgccaataatgacgat
gtgtcgattcaatcgtag

DBGET integrated database retrieval system