KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A7.11Help
Entry
SPAC57A7.11       CDS       T00076                                 

Gene name
mip1
Definition
WD repeat-containing protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(1517349..1521290)
Genome map
AA seq 1313 aa AA seqDB search
MNDRISEVSGSSRARRSVLSYGTTETGSDRYTENSNIATENGVDTASSMIDGIQSGFPQP
RHGFEEEYNNAEYINMLEQVFYMYYTDKRHRGVISKKNAEPTETIHDWRMRERLKTVSAA
LLVCLNIGVDPPDVIKPNPAAKYECWIDPFSLPASKALEAIGKNLQQQYETLSMRTRYRH
YLDPAIEEVKKLCIGQRRNAKEERILFHYNGHGVPMPTASGEIWVFNKNYTQYIPVSLYD
LQSWLGAPCIYVYDCSAAGNIIVNFNRFAEQRDKEALRIAKQNPNVLAMPSHTSCIQLAA
CGPKETLPMNPDLPADLFTSCLTSPIEISVRWYVLQNPFPNKLNLNMLLKIPGRLQDRRT
PLGELNWIFTAITDTIAWNVFPKHLFRRLFRQDLMVAALFRNFLLAERIMLVHSCHPQSS
PELPPTHDHPMWNSWDLAIDNCLSQLPDMLDAESKGIAYEYKHSTFFSEQLTAFEVWLSQ
GLISRKPPDQLPLVLQVLLSQVHRLRALILLSKFLDLGVWAVDLALSIGIFPYVLKLLQS
PAIELKPVLVFIWARILAVDDSCQADLLKDNGYGYFVQILNPNSSIFPSSNISEHRAMCA
FILSVFCRGFPQGQLACLNPQVLSHCLSHLNSPDSLLRQWACLCISQLWENYSEAKWSGT
RDNAHVKLAEIIVDSVPEVRASVLTAFTTFLGFPEKTEEVVAVETYIAIAALAALSDASP
LVRHELVIFLSHFVVNYKKQLMVVAYESSLADILEKKNHNSISASTIYETVWQAVLVLAA
DPSIEISLAAEAIINYVYQSMLNSELRESFLAFLLQHLPALHKASLSKDTDTNSVTSDPK
PHPFVPSVSENKILNRSFSLTRSLKGLALSLAGSDRASELLSLNGENKPAESNLNHLTSA
KVPGPPAFNELEYQSELDMPLTSYLFDWSRKYFTEPQMRPNEDDEPGSICYNQRLWRRNR
NEKLIYRTRPLAEYSTNGRWNQQLMTFNNTIAPRKLMFHQFEDQLITLGDKDIIQVWDWR
RNRCLNSFKTSASATTNVTDMQLLNEDDVALLMTGSSDGTIKLYRDYENEKVELVTSWNS
LSDLVFGDRNASLLMSWQQNCGHLLVAGDVRVIRIWDASKEICYANLPVRSSNSITSLTS
DLVGCNIIVAGFSDGVLRVYDKRLPARDSLTDVWKEHSSEIVNVEMQSSGMRELISASSD
GEVKLWDIRMNHSLQTFSTDNSGLTSLTVHSHAPVYATGSSNQSIKIWDTLGQNINTFRE
NPRFLNQPKPSSLMCLKFHPHHLLLACGDNTDSRVNLYSCTKNEIHTDSPNEF
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatagaattagtgaagtatctggtagctcaagggctcgtagatcagtcttaagc
tatggaacaaccgagaccggaagcgatagatacacagagaacagcaacattgctacagag
aatggtgtcgatacagcgagttcaatgatagatgggatacagtccggattcccgcaacct
agacatggttttgaagaagagtacaacaatgctgaatatataaacatgttagagcaggtc
ttttacatgtattacactgataaacggcatcggggggtgatcagcaaaaagaatgccgaa
cctactgaaacaattcatgattggagaatgcgcgaacggcttaaaactgtttctgcagca
ttgttagtttgcttaaacataggggtggatcctcctgatgttataaagcctaatcctgca
gcgaaatatgaatgttggattgatccgttttcattacctgcttctaaagcacttgaagcc
attggcaagaacttgcagcaacaatatgaaacattaagtatgagaacaagatataggcat
taccttgatcccgcaattgaagaagtcaaaaaactttgcattggtcaaagacgaaacgct
aaagaggaacggatcctttttcattataatggtcatggtgtcccaatgcctactgcctct
ggtgaaatctgggttttcaataaaaattatactcaatacattcctgtatcgctttatgac
ttacaatcttggcttggagcgccttgtatatatgtttacgattgtagcgcagctgggaat
atcatagtgaattttaatcgttttgccgagcagagagacaaagaagctctccgtattgct
aagcaaaatcccaatgtgctcgctatgccttctcatactagttgtattcaacttgctgct
tgtgggcctaaagaaacccttccgatgaacccagatctgccagctgatttgtttacttct
tgccttacctccccaattgaaatttcggttcgttggtatgtcttgcaaaacccgtttcct
aataagcttaatttgaatatgcttcttaaaattcccggtcgcttgcaagatcggcgtact
ccattaggcgaattaaactggatatttactgctattacagatacgattgcttggaatgtc
tttccaaagcatcttttcagaagattatttaggcaagatcttatggtagcagcactgttt
cgtaactttctattagcggaacgtataatgctcgttcattcctgtcatcctcagtccagt
cctgaactcccccctacccacgatcatcctatgtggaattcttgggatttggccattgat
aattgtctatctcagttacctgatatgcttgatgctgaaagcaaaggcatagcctacgag
tacaagcattcgacattttttagtgagcaattaactgcctttgaggtatggctctctcaa
ggactaattagcagaaagccaccggatcaattaccgctagttttgcaggtattactttca
caagttcatcgattgcgtgcactaattcttctctcaaaatttctggatctcggggtgtgg
gcggtagatttagcgctctctattggtatatttccttacgttttgaaacttctccagtct
ccagctattgagttaaagcctgtgttggtatttatttgggcgagaatccttgctgtagat
gattcttgtcaagctgacttactaaaagacaatggctatggatattttgtccaaattttg
aaccctaattcttccatttttccttcaagtaatatttccgaacaccgagcaatgtgtgcg
ttcatcctcagtgttttttgtcgtgggttcccacaaggccagctagcttgtttaaaccca
caggttttatcacattgtctttcccatttaaatagtcccgactctttattaagacaatgg
gcttgcctatgtatttctcagctttgggaaaattactctgaagctaaatggtctggaact
cgtgataatgcacatgtaaaattagctgaaatcatcgttgactccgttcctgaagttcgt
gcatcagttttaacagcgtttaccacttttttgggatttcctgagaagaccgaagaagtc
gttgctgttgaaacttatattgcaattgcggcgttagcagctctttctgatgcgtcacca
ttagttcgacatgaactagtgatattcctttctcactttgtagtgaattataagaagcaa
ttaatggtagttgcgtatgagagcagtttagcagatatccttgagaaaaagaaccacaat
tctatcagtgcttcgacaatttacgaaacagtttggcaagctgttttggttttggctgca
gatccaagcatcgaaatttctcttgcagctgaagccataataaattacgtttatcagagt
atgctaaattctgaattaagagaatcatttttagcatttcttctgcaacacttacctgct
ctccataaagcttctctttccaaagataccgatactaattcagttacgagcgacccgaag
ccacatcccttcgttccttctgtttcagaaaacaaaatcttgaacaggtcattctctctg
actagatcgttgaaaggcttggctttaagcctggcaggaagtgatcgcgcttctgaatta
ctttccttaaatggagaaaacaaacctgcagagtctaatttaaatcacttaacttccgcc
aaagttcctggtccacctgcatttaatgaacttgaataccaatccgagctagacatgccg
cttacaagttacttatttgattggtctcgtaagtattttaccgaaccccaaatgcggccg
aacgaagacgatgaacctggaagtatttgctataatcaacgtttgtggagaagaaacaga
aacgaaaaacttatttatcgtactcgtccccttgctgaatactcaaccaacggtcgttgg
aatcaacaacttatgacatttaataatactatcgctcctaggaagcttatgtttcaccaa
tttgaagatcagttaattacattaggtgacaaagatatcattcaggtatgggactggcgt
cgcaatcgttgcctcaattctttcaaaacttcagcaagtgcgacaactaacgtgaccgac
atgcaattactaaatgaagatgatgttgctttattgatgactgggtcttctgatggcaca
attaaactgtatcgtgactacgaaaatgaaaaggttgaactggtaacttcgtggaattct
ctaagtgatcttgtctttggagatcgaaatgctagccttttaatgagttggcaacagaac
tgtgggcacttgcttgttgctggagacgtacgcgttattcgaatatgggatgcttctaaa
gaaatctgctatgcaaacctaccagtaagaagcagtaatagtattacaagtttaactagc
gatttggtcggttgtaatattatagttgctggattttcagatggagttcttcgtgtttac
gacaaacgattgcctgcaagagattcactaacggatgtttggaaagaacattcgtccgag
atcgtcaatgttgaaatgcaatcctccggaatgcgagaattgatttcggcgagttcagat
ggtgaagttaagctatgggatattaggatgaatcattctttacagactttttcaacagac
aactctggactcacctctttaactgtgcatagtcacgccccagtttatgcaaccggttcc
tcaaatcaaagcataaaaatttgggacacgttaggccagaatattaataccttccgtgaa
aatccacggttccttaatcagcctaaaccatccagtttaatgtgcctgaagtttcacccg
catcatttattacttgcatgtggtgataacacagatagtagagttaatctatactcttgc
accaaaaacgagattcatacggattcgccgaacgagttttaa

DBGET integrated database retrieval system