KEGG   Schizosaccharomyces pombe (fission yeast): SPAC637.12cHelp
Entry
SPAC637.12c       CDS       T00076                                 

Gene name
mst1, kat5
Definition
KAT5 family histone acetyltransferase Mst1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPAC637.12c (mst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(4561384..4562775)
Genome map
AA seq 463 aa AA seqDB search
MSNDVDDESKIETKSYEAKDIVYKSKVFAFKDGEYRKAEILMIQKRTRGVVYYVHYNDYN
KRLDEWITIDNIDLSKGIEYPPPEKPKKAHGKGKSSKRPKAVDRRRSITAPSKTEPSTPS
TEKPEPSTPSGESDHGSNAGNESLPLLEEDHKPESLSKEQEVERLRFSGSMVQNPHEIAR
IRNINKICIGDHEIEPWYFSPYPKEFSEVDIVYICSFCFCYYGSERQFQRHREKCTLQHP
PGNEIYRDDYISFFEIDGRKQRTWCRNICLLSKLFLDHKMLYYDVDPFLFYCMCRRDEYG
CHLVGYFSKEKESSENYNLACILTLPQYQRHGYGKLLIQFSYELTKREHKHGSPEKPLSD
LGLISYRAYWAEQIINLVLGMRTETTIDELANKTSMTTNDVLHTLQALNMLKYYKGQFII
CISDGIEQQYERLKNKKRRRINGDLLADWQPPVFHPSQLRFGW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgatgttgatgatgagtccaagattgaaacaaagtcttatgaggctaaagac
atagtttataaatccaaagtctttgcatttaaggatggagaatatcgaaaggcggagatt
ttaatgattcaaaaaagaactagaggcgtcgtctactatgtacactataatgactacaat
aaacgtttagatgaatggattacaatagataatattgatttatcgaaaggaattgagtat
ccaccgccggagaagccaaaaaaggctcatggaaaaggaaaatcctcaaaacgtccaaaa
gctgttgacagacgacgatcgattacagcaccttcaaaaactgagccttcgacgccttct
acggagaaacctgaaccatccaccccttctggagaaagtgatcatggatcaaatgccggg
aatgaaagtttaccgttattggaggaagaccacaagcccgaaagtctttcaaaagaacaa
gaagtagaaaggttacggttcagtggctcaatggttcaaaatcctcacgaaatagctcga
attcgtaatataaacaaaatttgcataggagatcatgaaattgaaccttggtacttctca
ccgtaccctaaagaattttcggaagtagatatagtttatatttgcagtttttgtttctgc
tattacggatctgagcgacaatttcaaagacaccgcgaaaaatgtacattgcagcatcca
cccggaaatgaaatataccgtgatgactatatatccttttttgaaattgatggaagaaag
caacgtacatggtgtaggaatatttgtcttttgtccaaactttttctggatcacaaaatg
ctttactatgatgttgatccctttttgttttactgtatgtgtcgccgcgatgaatatgga
tgtcacttggtaggatatttctcaaaagaaaaagagtcctccgaaaattacaaccttgct
tgtatcttaactttacctcaataccaaagacatggttatggcaagttactcatacaattt
tcttatgaattgaccaagcgtgagcacaaacacggctcacctgaaaaaccactttctgat
ttggggttgattagttatcgagcgtattgggctgaacaaatcatcaaccttgtgcttgga
atgcgaactgaaaccactattgacgaattagccaacaaaacttcaatgactactaatgat
gtgctacatacacttcaagcactaaatatgcttaaatattacaaaggtcaatttattatc
tgtatttcagatggaattgagcaacaatacgaaagattgaagaacaaaaaaagaagaagg
atcaatggagatttgttggcagattggcaacctcctgtttttcacccttcccaactacga
tttggatggtaa

DBGET integrated database retrieval system