KEGG   Schizosaccharomyces pombe (fission yeast): SPAC644.11cHelp
Entry
SPAC644.11c       CDS       T00076                                 

Gene name
pkp1
Definition
[pyruvate dehydrogenase (acetyl-transferring)] kinase Pkp1 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     SPAC644.11c (pkp1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   SPAC644.11c (pkp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(2692031..2692174,2692234..2693106,2693186..2693352,2693436..2693529))
Genome map
AA seq 425 aa AA seqDB search
MSVLGKTLQEKVNLLAQYPQTGLSLKQLVYFGKNPTPGTLFRAGLFLRDELPIRLARRIQ
DLQNLSPMLRSMKRISSVKAAYGRSMEEIIELKGVELPKCLPKHARYHNAPKWRSSLMDS
EILHNPSLANTHLDSSKGRYFETDFSDQDNGVDCNWPESLLKFNSNFAYLLNTIRTRHDN
VAVEIALDIQEYRRKTNQIDNSIQIFLDRFYMSRIGIRMLLGQYIALVSEPPRENYVGVI
STRANIYQIIEGAAENAKYICRLAYGLFEAPEIQIICDPSLEMMYVESHLNHAVFEILKN
SLRATVEFHGVDSDFFPPIKVIVAKGQEDITIKISDEGGGISRRNIPLVWSYMFTTASPT
LTDDPHDIVSANSTTPMAGFGFGLPLARLYTRYFGGDLELISMEGYGTDVYIHLNRLCES
AEPLQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgctcgggaaaactttacaggagaaagtcaatctcttggctcaatatcctcaa
acagggttgtctttaaagcaattagtgtattttggcaagaaccctacaccaggaacactt
ttccgggctggcttgtttttgcgagatgaattgcccattcgcttggctcggcgcatccaa
gacctgcagaatctttcaccgatgctacgaagtatgaagcgtatatcttccgtaaaggct
gcttacggtagatctatggaggaaattattgaactgaaaggagtggaactaccgaaatgt
cttccaaagcacgctcgatatcacaatgccccgaaatggaggtcaagtttaatggactct
gaaattcttcataatccctcgcttgcaaatactcatttagactcttcaaaaggtcgctat
tttgaaacagatttttctgaccaagataatggcgttgattgtaattggcccgaatctttg
ttaaaatttaatagtaattttgcataccttttaaataccattcgaactagacacgataac
gttgcagtcgaaattgctttggacatacaagaataccgaaggaagactaaccaaattgac
aacagtattcaaatatttttggataggttttacatgtctcgtattggaattcgaatgctg
ttaggtcaatatatagcacttgtctctgaaccgccgcgtgagaattacgttggtgtgata
agtacacgtgcaaatatttatcaaataatagaaggtgctgctgaaaatgccaagtacatt
tgcaggcttgcgtacggattgtttgaagcacctgagattcaaattatttgcgatccttca
cttgaaatgatgtatgtagagtcccatttaaatcacgcagtctttgaaattctcaaaaac
agtcttcgtgcaaccgtagaatttcatggtgtagacagtgatttctttcctcccataaag
gtcattgttgcaaaaggacaagaggatataaccatcaaaatctctgatgaaggaggcggt
atatcccgtcgaaatatccctttagtttggtcatacatgtttacaactgcctctcctaca
ttgacagatgatcctcacgatatcgttagcgcaaattctactactcctatggctggcttc
gggtttggtcttcctctcgctcgactttatactaggtattttggtggagatcttgagcta
atttcaatggaggggtacggaaccgatgtatacatacacctaaatcgtctttgcgaaagt
gctgaaccgcttcagtga

DBGET integrated database retrieval system