KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6F12.15cHelp
Entry
SPAC6F12.15c      CDS       T00076                                 

Gene name
cut9, dre1
Definition
anaphase-promoting complex subunit Cut9
Orthology
K03353  
anaphase-promoting complex subunit 6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:spo04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(join(1342632..1342922,1342979..1343114,1343168..1344756))
Genome map
AA seq 671 aa AA seqDB search
MVVKRTQTDSRMQSTPGNHNHPDAHANAAYMTPPSMGALNANNSNSQLSTLTISPMTYLA
NNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDA
FWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFR
KDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQL
VSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSING
LEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYL
ISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIE
GEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNE
LGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALN
QGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEENSLT
SGFLNSKYVFEDEVSEYMQQSNLNTSDKSMSMEDQSGKVTESVNDRTQVLYADSRSEMMM
DDIEGNVSEQR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttaaacgaacgcaaactgactctcgaatgcagtctactcctggtaatcataat
catccagatgcacatgcaaatgcagcttatatgacacctccttctatgggtgctttgaat
gcgaataattccaattcacaattgtcaactttgacaataagtcccatgacttatttagct
aataatacatcgacagatggatcctttttaaaagaaaggaatgctcaaaacacagattca
ttgtctagagaagattacttgagactgtggaggcatgatgcactgatgcaacaacagtat
aaatgtgctgcatttgtaggagaaaaggttttagacataactgggaatccaaatgatgca
ttttggcttgcacaggtatattgctgtactggagactatgccagggcaaaatgtcttttg
actaaagaagacttgtataatcgaagctctgcttgtcgataccttgctgccttttgctta
gtaaaactatatgactggcaaggagcacttaatcttttaggtgaaactaacccttttcgt
aaagatgaaaagaatgctaataaactgctcatgcaagatggcggtataaaactagaagct
tcgatgtgctatcttcgcggccaagtttacacaaacctgagcaactttgatcgagctaag
gagtgttacaaagaagcgttaatggttgatgctaaatgttatgaagcttttgatcaattg
gtttctaaccatctccttactgctgatgaagagtgggatctcgttctaaaacttaactat
tccacttattctaaagaggacgcagcatttttgagatctctctatatgttaaaacttaat
aaaacttcacacgaagatgaacttcggagggccgaggattatctttcttctatcaatgga
ctcgaaaaatcctctgatcttcttttatgcaaagcagacactctgtttgtgcggtctcga
tttattgatgtattggccattaccacaaagattttagaaatagatccgtacaatttagat
gtttatcccttacatttggcttcccttcacgaatcaggagaaaaaaataagctatatcta
atttcaaatgatctggttgacaggcatcctgaaaaagctgtgacgtggttagcagtgggt
atatattacctttgtgtaaacaaaatttctgaggctaggagatatttttctaaatcatct
acgatggatccacaattcggtccagcatggattggatttgcacattcctttgctatagag
ggtgagcatgatcaagcaatttcagcttatacgacggcggcaagactatttcaaggcaca
catcttccatatttatttctcggtatgcaacacatgcagctaggaaatattttattagca
aatgagtacctccaaagctcttatgcactttttcagtacgacccactcttgctgaatgaa
ttgggtgtcgtagcttttaacaaatctgatatgcaaactgcaattaatcatttccaaaac
gctttgctacttgtaaagaaaacgcaaagcaatgaaaaaccttgggctgctacttgggcc
aacttaggtcatgcttatcgtaaattaaagatgtatgacgctgcaatagatgcccttaac
caagggttactactttctacaaatgatgcaaatgttcatacagcgattgctttagtctat
ttgcataaaaaaatccctggtttagctattacccacttacacgagagtctggctatatct
cctaatgaaatcatggcttcggatttattgaaacgagcacttgaagaaaactccttaact
tctggttttcttaattcaaaatatgtctttgaagatgaggtgagtgaatacatgcagcaa
tcaaaccttaatacaagtgataaatcaatgagcatggaagaccagtcaggcaaggtgact
gaatccgtgaatgaccgtacacaggttctttatgcggattctcgatcagaaatgatgatg
gatgatattgaaggtaatgtctcagagcaacgataa

DBGET integrated database retrieval system