KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6F12.15cHelp
Entry
SPAC6F12.15c      CDS       T00076                                 

Gene name
cut9, dre1
Definition
anaphase-promoting complex subunit Cut9
Orthology
K03353  
anaphase-promoting complex subunit 6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC6F12.15c (cut9)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC6F12.15c (cut9)
   04113 Meiosis - yeast
    SPAC6F12.15c (cut9)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SPAC6F12.15c (cut9)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SPAC6F12.15c (cut9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(join(1342632..1342922,1342979..1343114,1343168..1344756))
Genome map
AA seq 671 aa AA seqDB search
MVVKRTQTDSRMQSTPGNHNHPDAHANAAYMTPPSMGALNANNSNSQLSTLTISPMTYLA
NNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDA
FWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFR
KDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQL
VSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSING
LEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYL
ISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIE
GEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNE
LGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALN
QGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEENSLT
SGFLNSKYVFEDEVSEYMQQSNLNTSDKSMSMEDQSGKVTESVNDRTQVLYADSRSEMMM
DDIEGNVSEQR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttaaacgaacgcaaactgactctcgaatgcagtctactcctggtaatcataat
catccagatgcacatgcaaatgcagcttatatgacacctccttctatgggtgctttgaat
gcgaataattccaattcacaattgtcaactttgacaataagtcccatgacttatttagct
aataatacatcgacagatggatcctttttaaaagaaaggaatgctcaaaacacagattca
ttgtctagagaagattacttgagactgtggaggcatgatgcactgatgcaacaacagtat
aaatgtgctgcatttgtaggagaaaaggttttagacataactgggaatccaaatgatgca
ttttggcttgcacaggtatattgctgtactggagactatgccagggcaaaatgtcttttg
actaaagaagacttgtataatcgaagctctgcttgtcgataccttgctgccttttgctta
gtaaaactatatgactggcaaggagcacttaatcttttaggtgaaactaacccttttcgt
aaagatgaaaagaatgctaataaactgctcatgcaagatggcggtataaaactagaagct
tcgatgtgctatcttcgcggccaagtttacacaaacctgagcaactttgatcgagctaag
gagtgttacaaagaagcgttaatggttgatgctaaatgttatgaagcttttgatcaattg
gtttctaaccatctccttactgctgatgaagagtgggatctcgttctaaaacttaactat
tccacttattctaaagaggacgcagcatttttgagatctctctatatgttaaaacttaat
aaaacttcacacgaagatgaacttcggagggccgaggattatctttcttctatcaatgga
ctcgaaaaatcctctgatcttcttttatgcaaagcagacactctgtttgtgcggtctcga
tttattgatgtattggccattaccacaaagattttagaaatagatccgtacaatttagat
gtttatcccttacatttggcttcccttcacgaatcaggagaaaaaaataagctatatcta
atttcaaatgatctggttgacaggcatcctgaaaaagctgtgacgtggttagcagtgggt
atatattacctttgtgtaaacaaaatttctgaggctaggagatatttttctaaatcatct
acgatggatccacaattcggtccagcatggattggatttgcacattcctttgctatagag
ggtgagcatgatcaagcaatttcagcttatacgacggcggcaagactatttcaaggcaca
catcttccatatttatttctcggtatgcaacacatgcagctaggaaatattttattagca
aatgagtacctccaaagctcttatgcactttttcagtacgacccactcttgctgaatgaa
ttgggtgtcgtagcttttaacaaatctgatatgcaaactgcaattaatcatttccaaaac
gctttgctacttgtaaagaaaacgcaaagcaatgaaaaaccttgggctgctacttgggcc
aacttaggtcatgcttatcgtaaattaaagatgtatgacgctgcaatagatgcccttaac
caagggttactactttctacaaatgatgcaaatgttcatacagcgattgctttagtctat
ttgcataaaaaaatccctggtttagctattacccacttacacgagagtctggctatatct
cctaatgaaatcatggcttcggatttattgaaacgagcacttgaagaaaactccttaact
tctggttttcttaattcaaaatatgtctttgaagatgaggtgagtgaatacatgcagcaa
tcaaaccttaatacaagtgataaatcaatgagcatggaagaccagtcaggcaaggtgact
gaatccgtgaatgaccgtacacaggttctttatgcggattctcgatcagaaatgatgatg
gatgatattgaaggtaatgtctcagagcaacgataa

DBGET integrated database retrieval system