KEGG   Schizosaccharomyces pombe (fission yeast): SPAC7D4.09cHelp
Entry
SPAC7D4.09c       CDS       T00076                                 

Definition
steroid dehydrogenase (predicted)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     SPAC7D4.09c
    1.3.1.94  polyprenol reductase
     SPAC7D4.09c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:2622666..2623490
Genome map
AA seq 274 aa AA seqDB search
MQLLNNWYSLLLTEVAAYFTSTTLFVSILKNAPSLSWLMKYGGHDNFGLKPPLIATKLEV
PKRWFWHFYAFISLLNPLFTFFILNTNFPIPIFKNIKEDLMYSKKLQVLLLIYEIHTLRR
LYENLRFRKSGSKMLAGHYLLGYLFYTHTFLALLLCGRRSYENTMSSMQFVGLGIYAIGS
IWQNASHEHLIAQKNHSQYLVLKKGCFKWITGPHYLGEIIVYTGIALIAQHWLIWLVLGW
VLCNMVAISSSYACTVKNKEQSLDFRWTLIPFLY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgcttaataactggtattcgttactcttgactgaggtagctgcatattttacg
agcacaactctgtttgttagtattttaaaaaacgcgcctagtctaagctggttaatgaaa
tacggaggtcatgataattttgggttaaagcctcctctaattgctaccaagcttgaagta
cctaaacggtggttttggcatttttacgcgtttatttccctcttgaatccattgtttaca
ttttttatcctaaataccaattttcctattcctatatttaaaaatatcaaagaggacttg
atgtacagtaaaaagctacaagtactcctactaatttatgaaattcacacgctgcgtaga
ttatatgagaatctacgttttcgcaaaagcggttcgaaaatgcttgctggtcattattta
ttgggatacctgttttacacacatacattccttgcattgcttttgtgcggtagaagaagt
tatgaaaatacaatgtcaagcatgcaatttgttggtttggggatttacgcaataggcagc
atttggcagaatgcaagtcatgaacatttgattgctcaaaaaaatcattcgcaatatcta
gtcctaaaaaaaggatgttttaaatggataactggcccccattaccttggagaaatcatt
gtttatactggaatagcactgattgcccaacactggttaatatggctagtcttgggatgg
gtactttgcaatatggtagcaatctcttcttcttatgcttgtacggtcaagaacaaagaa
caaagtttggactttcggtggactcttataccttttctatactaa

DBGET integrated database retrieval system