KEGG   Schizosaccharomyces pombe (fission yeast): SPAC821.08cHelp
Entry
SPAC821.08c       CDS       T00076                                 

Gene name
slp1, cdc20
Definition
WD repeat-containing protein
Orthology
K03363  
cell division cycle 20, cofactor of APC complex
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC821.08c (slp1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC821.08c (slp1)
   04113 Meiosis - yeast
    SPAC821.08c (slp1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    target recognizing subunit
     SPAC821.08c (slp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(995476..996942)
Genome map
AA seq 488 aa AA seqDB search
MEIAGNSSTISPTFSTPTKKRNLVFPNSPITPLHQQALLGRNGRSSKRCSPKSSFIRNSP
KIDVVNTDWSIPLCGSPRNKSRPASRSDRFIPSRPNTANAFVNSISSDVPFDYSESVAEA
CGFDLNTRVLAFKLDAPEAKKPVDLRTQHNRPQRPVVTPAKRRFNTTPERVLDAPGIIDD
YYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDESTYVASVKWSHDGSFLSVGL
GNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTL
QGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSN
LLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWS
YSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVYDGDHVKRPIPITKT
PSSSITIR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggagatagcaggtaattcttcaaccatatcgcctacattttcaacacccacaaagaaa
aggaacttagtcttccctaacagccctataactcccctgcatcagcaggcacttttaggc
cgtaacggtcgttcttccaagcgttgctcccctaaatcttcttttatcagaaactcacca
aaaatcgatgtagtaaatacagattggtctattccactatgcggatcaccacgaaacaaa
agtcgtcctgccagtcgaagtgaccgctttattccttctcgtccaaacactgctaatgct
tttgtaaattctatcagcagtgacgttccttttgattatagtgaatcagttgctgaagca
tgcggttttgatttaaacacgcgtgttctcgcctttaaattggatgctcctgaggccaaa
aagcctgtagacttgcgcactcaacacaatcggcctcaaagacctgtggttacaccggct
aaacgacgctttaacactactcctgaacgagttttagatgctcctggtatcattgatgat
tactacttgaatttgctggattggtcaaacttaaacgtcgttgctgttgctttggagcgc
aatgtgtatgtttggaatgctgatagtggttcggttagcgctttggcagaaaccgatgaa
tcaacctatgttgctagtgtaaaatggtctcacgatggttcatttttatccgtcggtctt
ggaaacgggctcgttgatatatatgatgttgaatcacagacaaaacttcgaacaatggca
ggccatcaagctagagttggttgtctctcctggaatcgtcacgttctgtcgagtggtagc
cgttctggcgctattcatcatcatgatgtgcgtatcgctaatcatcagattgggactctt
cagggacactctagtgaagtctgtggtttggcgtggcgttcagacggtcttcagttggcc
tctggcggtaatgacaacgttgttcaaatttgggatgccagatcttcgattcccaaattt
accaaaaccaaccataacgctgctgtaaaggcagttgcttggtgcccttggcaaagtaat
ctattggcgacaggcggtggcacaatggataaacagattcacttttggaatgctgccact
ggtgcaagagttaacaccgtggatgcgggtagtcaggtcacttcactgatttggagccct
cattctaaagaaatcatgtctactcatggctttccagataacaatttgtctatatggtct
tatagtagcagcggattaaccaaacaagttgatattcctgcacatgatacccgagttttg
tattcagctttatcgcctgatggaagaattctttcaactgcagccagtgatgagaatctg
aaattttggcgagtttatgatggggaccacgttaaaaggcccattccaattaccaaaacc
ccgtccagcagcataacaatccgttga

DBGET integrated database retrieval system