KEGG   Schizosaccharomyces pombe (fission yeast): SPAC821.08cHelp
Entry
SPAC821.08c       CDS       T00076                                 

Gene name
slp1, cdc20
Definition
WD repeat-containing protein
Orthology
K03363  
cell division cycle 20, cofactor of APC complex
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:spo04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(995476..996942)
Genome map
AA seq 488 aa AA seqDB search
MEIAGNSSTISPTFSTPTKKRNLVFPNSPITPLHQQALLGRNGRSSKRCSPKSSFIRNSP
KIDVVNTDWSIPLCGSPRNKSRPASRSDRFIPSRPNTANAFVNSISSDVPFDYSESVAEA
CGFDLNTRVLAFKLDAPEAKKPVDLRTQHNRPQRPVVTPAKRRFNTTPERVLDAPGIIDD
YYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDESTYVASVKWSHDGSFLSVGL
GNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTL
QGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSN
LLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWS
YSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVYDGDHVKRPIPITKT
PSSSITIR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggagatagcaggtaattcttcaaccatatcgcctacattttcaacacccacaaagaaa
aggaacttagtcttccctaacagccctataactcccctgcatcagcaggcacttttaggc
cgtaacggtcgttcttccaagcgttgctcccctaaatcttcttttatcagaaactcacca
aaaatcgatgtagtaaatacagattggtctattccactatgcggatcaccacgaaacaaa
agtcgtcctgccagtcgaagtgaccgctttattccttctcgtccaaacactgctaatgct
tttgtaaattctatcagcagtgacgttccttttgattatagtgaatcagttgctgaagca
tgcggttttgatttaaacacgcgtgttctcgcctttaaattggatgctcctgaggccaaa
aagcctgtagacttgcgcactcaacacaatcggcctcaaagacctgtggttacaccggct
aaacgacgctttaacactactcctgaacgagttttagatgctcctggtatcattgatgat
tactacttgaatttgctggattggtcaaacttaaacgtcgttgctgttgctttggagcgc
aatgtgtatgtttggaatgctgatagtggttcggttagcgctttggcagaaaccgatgaa
tcaacctatgttgctagtgtaaaatggtctcacgatggttcatttttatccgtcggtctt
ggaaacgggctcgttgatatatatgatgttgaatcacagacaaaacttcgaacaatggca
ggccatcaagctagagttggttgtctctcctggaatcgtcacgttctgtcgagtggtagc
cgttctggcgctattcatcatcatgatgtgcgtatcgctaatcatcagattgggactctt
cagggacactctagtgaagtctgtggtttggcgtggcgttcagacggtcttcagttggcc
tctggcggtaatgacaacgttgttcaaatttgggatgccagatcttcgattcccaaattt
accaaaaccaaccataacgctgctgtaaaggcagttgcttggtgcccttggcaaagtaat
ctattggcgacaggcggtggcacaatggataaacagattcacttttggaatgctgccact
ggtgcaagagttaacaccgtggatgcgggtagtcaggtcacttcactgatttggagccct
cattctaaagaaatcatgtctactcatggctttccagataacaatttgtctatatggtct
tatagtagcagcggattaaccaaacaagttgatattcctgcacatgatacccgagttttg
tattcagctttatcgcctgatggaagaattctttcaactgcagccagtgatgagaatctg
aaattttggcgagtttatgatggggaccacgttaaaaggcccattccaattaccaaaacc
ccgtccagcagcataacaatccgttga

DBGET integrated database retrieval system