KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.07cHelp
Entry
SPAC869.07c       CDS       T00076                                 

Gene name
mel1
Definition
alpha-galactosidase, melibiase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:spo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spo00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:5499782..5501092
Genome map
AA seq 436 aa AA seqDB search
MISISFLNCFFLVFLFLFFSDVHGSYNGLGLKPQMGWNSWNKYACDIDESIILNNAKAIK
EEGLLDLGYEYIVMDDCWSKHERNATTGRLEANPDKFPNGIGSMAKKLHDMGFKFGMYSS
AGKYTCAGFPGSLNHEQIDADTFADWGVDYLKYDNCFNEGKSGVPLISYERYKRMSDALN
KTGRPIFYSLCQWGEDFVWNWGNTIANSWRISGDIFDTFSRKDVRCPCETIECFALQGDH
CSVMNIISKASFLSSKAGMNSGWNDLDSLEVGNGGMSFEEYKTHFTMWAILKSPLILGND
VSSMSPMDKLIVSNKELISINQDIGTNPAALIWKKKYGDEYIELFSGRLSNNDWVVAVLN
AASEPLKMGIHLSDIFVDALGNAEHDWLATDLWNNNVKLVSDRIRANVASHGVQVWRFQQ
YKVKNTNDKFFSFNKH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatatccatttcatttttaaattgcttttttttggtattcctttttttgtttttctca
gatgttcatggtagctataatggtttgggactaaaacctcaaatggggtggaattcttgg
aataaatatgcctgtgatatcgatgagtctataatccttaataatgccaaggctataaaa
gaggaaggacttcttgacttaggttatgagtatatagtaatggatgactgttggagcaag
catgagcggaatgcaaccactggtagattggaagcaaatcctgataaattccccaacgga
attggttcaatggcaaaaaaattacatgacatggggtttaaatttggaatgtactcaagt
gcagggaaatatacatgtgctggatttcctggatcattaaaccatgagcaaattgatgct
gatacatttgcagattggggagtagattacttaaagtatgacaattgcttcaacgaaggg
aaaagcggcgttcccttgattagctatgaacgttacaagcgaatgtctgatgctctaaac
aaaactggaagaccaattttttactctttatgccaatggggtgaagattttgtttggaat
tggggaaatacaatagctaactcttggaggataagtggagatatctttgatacatttagt
cgtaaggatgtgcgttgtccgtgcgagacaatcgaatgttttgcgcttcagggagatcat
tgttcagtaatgaatattattagtaaagcatcgtttcttagttctaaagcaggtatgaac
agtggatggaacgatcttgattcgttagaggttggaaatggaggtatgagctttgaggag
tataaaactcatttcacaatgtgggcaatactaaaatctccccttatacttggtaacgat
gtcagtagcatgtctcctatggataagttaattgtatccaacaaagagttaatttctata
aatcaagatattggtacaaatcctgctgctcttatttggaaaaaaaaatacggtgacgaa
tatatagagcttttttctggaaggctttccaataatgattgggtagtggctgttctgaat
gctgccagtgaacctctcaaaatgggcattcatttatctgatatatttgttgatgcattg
ggtaacgccgagcacgattggcttgctactgatttgtggaataataatgttaaacttgtt
tccgatcgcataagagctaatgttgcttcacatggcgttcaggtgtggaggtttcagcaa
tacaaagtgaaaaacacaaacgacaaatttttttctttcaataaacactaa

DBGET integrated database retrieval system