KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.07cHelp
Entry
SPAC869.07c       CDS       T00076                                 

Gene name
mel1
Definition
alpha-galactosidase, melibiase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPAC869.07c (mel1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPAC869.07c (mel1)
   00600 Sphingolipid metabolism
    SPAC869.07c (mel1)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    SPAC869.07c (mel1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SPAC869.07c (mel1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:5499782..5501092
Genome map
AA seq 436 aa AA seqDB search
MISISFLNCFFLVFLFLFFSDVHGSYNGLGLKPQMGWNSWNKYACDIDESIILNNAKAIK
EEGLLDLGYEYIVMDDCWSKHERNATTGRLEANPDKFPNGIGSMAKKLHDMGFKFGMYSS
AGKYTCAGFPGSLNHEQIDADTFADWGVDYLKYDNCFNEGKSGVPLISYERYKRMSDALN
KTGRPIFYSLCQWGEDFVWNWGNTIANSWRISGDIFDTFSRKDVRCPCETIECFALQGDH
CSVMNIISKASFLSSKAGMNSGWNDLDSLEVGNGGMSFEEYKTHFTMWAILKSPLILGND
VSSMSPMDKLIVSNKELISINQDIGTNPAALIWKKKYGDEYIELFSGRLSNNDWVVAVLN
AASEPLKMGIHLSDIFVDALGNAEHDWLATDLWNNNVKLVSDRIRANVASHGVQVWRFQQ
YKVKNTNDKFFSFNKH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatatccatttcatttttaaattgcttttttttggtattcctttttttgtttttctca
gatgttcatggtagctataatggtttgggactaaaacctcaaatggggtggaattcttgg
aataaatatgcctgtgatatcgatgagtctataatccttaataatgccaaggctataaaa
gaggaaggacttcttgacttaggttatgagtatatagtaatggatgactgttggagcaag
catgagcggaatgcaaccactggtagattggaagcaaatcctgataaattccccaacgga
attggttcaatggcaaaaaaattacatgacatggggtttaaatttggaatgtactcaagt
gcagggaaatatacatgtgctggatttcctggatcattaaaccatgagcaaattgatgct
gatacatttgcagattggggagtagattacttaaagtatgacaattgcttcaacgaaggg
aaaagcggcgttcccttgattagctatgaacgttacaagcgaatgtctgatgctctaaac
aaaactggaagaccaattttttactctttatgccaatggggtgaagattttgtttggaat
tggggaaatacaatagctaactcttggaggataagtggagatatctttgatacatttagt
cgtaaggatgtgcgttgtccgtgcgagacaatcgaatgttttgcgcttcagggagatcat
tgttcagtaatgaatattattagtaaagcatcgtttcttagttctaaagcaggtatgaac
agtggatggaacgatcttgattcgttagaggttggaaatggaggtatgagctttgaggag
tataaaactcatttcacaatgtgggcaatactaaaatctccccttatacttggtaacgat
gtcagtagcatgtctcctatggataagttaattgtatccaacaaagagttaatttctata
aatcaagatattggtacaaatcctgctgctcttatttggaaaaaaaaatacggtgacgaa
tatatagagcttttttctggaaggctttccaataatgattgggtagtggctgttctgaat
gctgccagtgaacctctcaaaatgggcattcatttatctgatatatttgttgatgcattg
ggtaacgccgagcacgattggcttgctactgatttgtggaataataatgttaaacttgtt
tccgatcgcataagagctaatgttgcttcacatggcgttcaggtgtggaggtttcagcaa
tacaaagtgaaaaacacaaacgacaaatttttttctttcaataaacactaa

DBGET integrated database retrieval system