KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.08Help
Entry
SPAC869.08        CDS       T00076                                 

Gene name
pcm2
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase Pcm2 (predicted)
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SPAC869.08 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 GCD14 PrmA Methyltransf_23 Methyltransf_32 MTS Ubie_methyltran Methyltransf_12 Fibrillarin Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 2543383
NCBI-ProteinID: NP_595011
PomBase: SPAC869.08
UniProt: Q9URZ1
Position
I:complement(5498273..5498965)
Genome map
AA seq 230 aa AA seqDB search
MFWSFNLSSNAALVQHLVESKFLTNQRAIKAMNATSRSFYCPLSPYMDSPQSIGYGVTIS
APHMHATALQELEPVLQPGCSALDIGSGSGYLVAAMARMVAPNGTVKGIEHIPQLVETSK
KNLLKDINHDEVLMEMYKEKRLQINVGDGRMGTSEDEKFDAIHVGASASELPQKLVDQLK
SPGKILIPIGTYSQNIYLIEKNEQGKISKRTLFPVRYVPLTDSPDDSSDY
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgttctggagttttaacctttcctctaatgctgcgttggttcagcatttggtagagtca
aaatttttgacgaatcagagagccatcaaggcaatgaatgctactagcagatcattttat
tgccctttaagtccgtatatggattcacctcaaagcataggatacggagttactatatct
gctcctcatatgcatgccacggctttacaagaacttgaaccggtcctccaacctggctgt
tctgccttggatattggttcaggtagtggttatttggtggccgctatggcccgaatggtt
gctccaaacggaactgtcaagggtattgagcacataccccagttggtggaaacttcaaaa
aaaaatttgctaaaagatattaatcatgatgaagttcttatggaaatgtacaaagaaaaa
agattgcaaataaatgtaggggatggaaggatgggtacgtctgaggatgaaaaattcgat
gccattcatgtgggtgcctcagcttcagagcttcctcagaaactggtcgatcaattgaag
tctcccggaaaaatccttataccgattggtacatattcgcaaaacatttacttaatcgaa
aaaaatgagcagggtaaaatatcgaaaagaacattgtttccggttcgatatgtaccgtta
actgactcaccagatgactcatcagattactag

DBGET integrated database retrieval system