KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.08Help
Entry
SPAC869.08        CDS       T00076                                 

Gene name
pcm2
Definition
protein-L-isoaspartate O-methyltransferase Pcm2 (predicted) (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(5498273..5498965)
Genome map
AA seq 230 aa AA seqDB search
MFWSFNLSSNAALVQHLVESKFLTNQRAIKAMNATSRSFYCPLSPYMDSPQSIGYGVTIS
APHMHATALQELEPVLQPGCSALDIGSGSGYLVAAMARMVAPNGTVKGIEHIPQLVETSK
KNLLKDINHDEVLMEMYKEKRLQINVGDGRMGTSEDEKFDAIHVGASASELPQKLVDQLK
SPGKILIPIGTYSQNIYLIEKNEQGKISKRTLFPVRYVPLTDSPDDSSDY
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgttctggagttttaacctttcctctaatgctgcgttggttcagcatttggtagagtca
aaatttttgacgaatcagagagccatcaaggcaatgaatgctactagcagatcattttat
tgccctttaagtccgtatatggattcacctcaaagcataggatacggagttactatatct
gctcctcatatgcatgccacggctttacaagaacttgaaccggtcctccaacctggctgt
tctgccttggatattggttcaggtagtggttatttggtggccgctatggcccgaatggtt
gctccaaacggaactgtcaagggtattgagcacataccccagttggtggaaacttcaaaa
aaaaatttgctaaaagatattaatcatgatgaagttcttatggaaatgtacaaagaaaaa
agattgcaaataaatgtaggggatggaaggatgggtacgtctgaggatgaaaaattcgat
gccattcatgtgggtgcctcagcttcagagcttcctcagaaactggtcgatcaattgaag
tctcccggaaaaatccttataccgattggtacatattcgcaaaacatttacttaatcgaa
aaaaatgagcagggtaaaatatcgaaaagaacattgtttccggttcgatatgtaccgtta
actgactcaccagatgactcatcagattactag

DBGET integrated database retrieval system