KEGG   Schizosaccharomyces pombe (fission yeast): SPAC8E11.04cHelp
Entry
SPAC8E11.04c      CDS       T00076                                 

Definition
phospholipase (predicted)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAC8E11.04c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPAC8E11.04c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:join(3380756..3380828,3380900..3380984,3381096..3381143,3381199..3381344,3381459..3381781)
Genome map
AA seq 224 aa AA seqDB search
MTAKLNSVIINPSVAHTATVIFLHGLGDSGQGWSFMANTWSNFKHIKWIFPNAPSIPVTV
NNGMKMPAWYDIYSFADMKREDENGILRSAGQLHELIDAELALGIPSDRILIGGFSQGCM
VSLYAGLTYPKRLAGIMGHSGFLPLASKFPSALSRVAKEIPILLTYMTEDPIVPSVLSSA
SAKYLINNLQLKCLDRPFEGDAHSLSSESFMAMYKFTQTVIGSP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaaactcaattcagtaataattaatcccagcgtggcgcatacggccactgtg
attttccttcatggtttaggagatagtggacaaggatggtcttttatggcaaatacgtgg
tcgaattttaagcatattaagtggatctttcccaatgctccatctatccctgttaccgtc
aacaatggcatgaaaatgccagcatggtatgatatctacagttttgcggatatgaagagg
gaggacgagaatgggatactacgttcagcaggccaattgcatgaattgattgatgcagaa
cttgctttggggattcctagtgatcgcatattaattggcggattttcacaaggttgtatg
gtttccctttacgctggacttacctatcccaaacgtttagcaggaattatggggcattca
gggttcttacctttggcttcaaaatttccatccgctctctctcgagttgctaaagagata
cccattcttttgacttatatgaccgaagatcctattgttccctctgtcttgtcgagtgct
tcagctaaatacctcatcaacaatctacagttaaaatgtctcgatcgaccttttgaggga
gacgcccactctctctcttcagaatcgtttatggctatgtataaatttactcagacagtt
attggttcaccataa

DBGET integrated database retrieval system