KEGG   Schizosaccharomyces pombe (fission yeast): SPAC9.08cHelp
Entry
SPAC9.08c         CDS       T00076                                 

Definition
steroid reductase (predicted)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     SPAC9.08c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(1477214..1478062)
Genome map
AA seq 282 aa AA seqDB search
MFYSDYLKLLKIFVVGVFPCTLFVNAPHGKLAKQSKLFSKGYISGRVGWVLMELVAPLTF
LYAIRNNRHFESTLPSLGDGSNRDYLDSCRKVLAGMFLVHYANRALVSPLLMAPQVSPMH
WTVFVSAVLFNFLNGMSIGLYLVQASVQHHPVSIIRRYIGMFLWLMGWLGNMYHDNILYD
LRRSSNKKKDPDNLDTVQSENSYYRIPYGGLFQYVSCPNYFCEWIEWFGCYLAAGPSAEP
FWWFFLSEILLMLPRALKAHQWYCKKFPKYPANRRAIIPFLM
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttttattcagactacctgaaactgttgaaaatattcgttgtcggagtgttcccatgc
actctgtttgtaaatgcgccgcatggcaaattagccaagcaaagcaaattattcagcaaa
ggatacatatcgggtagagtgggatgggtattgatggagctggtagcaccactgacgttc
ctttatgcaattcgtaacaatcgacacttcgagtcgacgctgccctctcttggagatggg
tcgaaccgagattatctggatagctgtcgaaaggtacttgctggtatgtttttagttcat
tacgccaaccgagcgctagtgagtcctcttttgatggcaccacaagtttcacccatgcat
tggacggtgtttgtttctgcggtattgtttaactttttgaacggtatgtcaataggtctg
tacttggttcaagctagcgtccagcatcatccagtgtctatcattcgtcgatacattggt
atgtttctttggttaatgggttggttgggaaatatgtatcacgacaacatcttatacgac
ctaagaagatcatctaataaaaaaaaggatcccgataatcttgacaccgtacaatctgag
aattcgtattatcgaattccctatggagggcttttccagtatgtttcgtgtcccaattac
ttttgcgaatggattgaatggtttggatgctacttggcagccggtccttctgccgaacct
ttttggtggttcttcctgtcagagattctgttgatgcttccaagagcattaaaagcccat
caatggtactgtaaaaagtttccgaagtatccagcaaaccgtcgtgccatcatcccattc
ttaatgtag

DBGET integrated database retrieval system