KEGG   Schizosaccharomyces pombe (fission yeast): SPAC959.09cHelp
Entry
SPAC959.09c       CDS       T00076                                 

Gene name
apc5, SPAP32A8.01c
Definition
anaphase-promoting complex subunit Apc5
Orthology
K03352  
anaphase-promoting complex subunit 5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC959.09c (apc5)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC959.09c (apc5)
   04113 Meiosis - yeast
    SPAC959.09c (apc5)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SPAC959.09c (apc5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(3401279..3401424,3401471..3401771,3401818..3401913,3401961..3402087,3402138..3402905,3402956..3403049,3403136..3403195,3403240..3403576,3403625..3403729,3403791..3403991))
Genome map
AA seq 744 aa AA seqDB search
MQSPAMSMVTPIFPIPLKTNSSKKNFYTTFLTPHKLTLCLLIELYAHRIIQPQHCVPFLD
LVLGYFNPNDSQPQTLTRIHDITSHLPSSIEEYSVYSLLHERLWSLHSFEDIHEIFISLG
NYIEGVYDSEEEAPHMLFSSSSLLSIFLRKCVVEYEQFSFEQGVQFFKSFLQYRAPSMDF
QHEGIEFCKINVRHELMNLASNKTLLQLAFGSIPVSRSSRDIEQLTQVQIEHMQKFGCAL
PLEMKEKLHDLLEVEENNLNTSYYCKFLNSWFSGDYQQSVENLCRYFDHIMHSDEKVSYQ
YALLNLAMLQADFGCNEEALHAIEDTINTARESGDTACLNFALAWMFEFKRSQYSNPSPE
KNENDDQILEHLARNSQKAQLPILQTTVHLLQVQKFLDDGSSLIGVFSNLTKAFALFCAN
ESFDGFPRYMDLLQSIWYRLGCSILSMTYISIYQKNHVHDSPALDLLQSLITKAWRYAEL
GRWLDVATILSTAEVQSQRSFQCAHLYGREKTFIYLSKAIDEKNHMDATLYLKNLNGFRH
DKMSTFRTQLYALRLDISLGNLSQAIEGIDKLLEEPEKLAIEWVLQLMFLKVDIYMRTEM
SNRAVFELLEIIQMASSNYLRLYLLRGLCTLCLIGELDCFTAIDLLDSLIPDIIAADNKP
LLALAFHAFASLQIKHLDLLQPSRMFVIQLLDSAIDGYRACYMVEMQKTVVRLKIQYLRQ
INDPALQPNIEQYCSRFYSDNLLN
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtcccgcgatgtcaatggtaacaccaatatttcccatacctttaaaaacaaat
tcttcaaaaaaaaatttttatactacctttttgacaccacataaattgacgctatgtttg
cttattgaactttatgcccatcgcatcattcaacctcaacattgtgtgcccttcctagat
ttggtattgggatattttaatcccaatgactcacaaccacaaacactgactcgaattcac
gacataacaagtcaccttcccagttcaattgaagaatatagcgtttacagtttattgcat
gaacgtctatggtccttgcattcttttgaagatattcatgaaatattcatttctcttgga
aactacatagaaggtgtttacgattctgaagaagaggccccccatatgcttttttcatcg
tcttcacttttatctattttccttcgaaagtgtgttgtggaatacgagcagttttcattc
gaacaaggggttcaattctttaaatcatttcttcaatacagagctccctcaatggatttt
caacatgaggggattgaattctgtaagattaatgttcgtcatgagttaatgaatttggct
agcaataagactctactacagttggcatttggaagtataccagtttctcgttctagtcgg
gatattgaacaactcactcaagttcaaattgaacacatgcaaaaatttggatgtgctctt
ccattggaaatgaaagaaaaattgcatgatttattagaagttgaagaaaacaatctaaat
actagctattattgcaaattcttaaattcctggtttagtggtgattatcagcaatccgtg
gaaaatctttgcagatattttgatcacattatgcattctgatgaaaaggtttcttatcag
tacgctctcctcaatcttgccatgcttcaagccgattttggctgtaatgaagaagctctt
catgcgattgaagatacgattaatactgctcgtgaaagcggcgatactgcttgtcttaat
tttgcattggcctggatgtttgagtttaagcggtcacaatactcgaatccttctccagaa
aaaaatgaaaacgatgatcaaatactagaacatcttgcgcgtaatagtcaaaaagctcaa
ctgcctatattacagacgacagttcatctcttacaggtccaaaaatttttagatgatgga
tctagtttaattggcgttttctctaatttgactaaggcatttgctttgttttgtgctaat
gaatcattcgatggtttccctcggtatatggacttgctacaaagcatttggtatcgttta
ggatgctctatcctttccatgacttatatttcgatctatcaaaaaaatcacgtccatgat
tctcctgcactcgacctattacaaagtcttataactaaggcatggaggtacgctgaatta
ggaagatggttagatgttgctacaattttgtcgactgctgaggttcaatcacagcgttct
tttcaatgcgcacatttatatggcagagaaaaaacatttatctacttatctaaggcgatt
gacgagaaaaatcatatggatgctaccctgtatttgaaaaatttaaatggctttagacac
gacaagatgtctacttttcgaactcaactctacgctttaaggttggatattagtttggga
aatttaagtcaggccattgaaggaattgataaattattggaagaaccggaaaaactggcg
attgaatgggtgctgcagttgatgtttttaaaggttgacatttatatgaggactgaaatg
tcaaatcgagctgtttttgaattgctggaaataattcaaatggcctcatcaaactattta
agattgtatcttctgagaggattatgcactttgtgcttgattggggaactggattgtttt
acagctatcgatctattagattcactaatccctgacataattgcagcggataacaaacca
ttacttgcattagcatttcatgcatttgcttctttgcagattaaacatcttgaccttttg
cagccttcacgaatgtttgtcattcagttgcttgatagtgctattgatggttatcgggcc
tgttacatggtagagatgcaaaaaactgttgtccgcctgaaaattcaatatttacgacaa
attaatgatcctgcactccagcccaacattgagcaatattgttctcgattctattccgac
aatttgctaaactaa

DBGET integrated database retrieval system