KEGG   Schizosaccharomyces pombe (fission yeast): SPAC9E9.06cHelp
Entry
SPAC9E9.06c       CDS       T00076                                 

Definition
threonine synthase (predicted) (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPAC9E9.06c
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAC9E9.06c
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPAC9E9.06c
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPAC9E9.06c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
I:complement(join(4445866..4447341,4447400..4447468))
Genome map
AA seq 514 aa AA seqDB search
MSSQVSYLSTRGGSSNFSFEEAVLKGLANDGGLFIPSEIPQLPSGWIEAWKDKSFPEIAF
EVMSLYIPRSEISADELKKLVDRSYSTFRHPETTPLKSLKNGLNVLELFHGPTFAFKDVA
LQFLGNLFEFFLTRKNGNKPEDERDHLTVVGATSGDTGSAAIYGLRGKKDVSVFILFPNG
RVSPIQEAQMTTVTDPNVHCITVNGVFDDCQDLVKQIFGDVEFNKKHHIGAVNSINWARI
LSQITYYLYSYLSVYKQGKADDVRFIVPTGNFGDILAGYYAKRMGLPTKQLVIATNENDI
LNRFFKTGRYEKADSTQVSPSGPISAKETYSPAMDILVSSNFERYLWYLALATEAPNHTP
AEASEILSRWMNEFKRDGTVTVRPEVLEAARRDFVSERVSNDETIDAIKKIYESDHYIID
PHTAVGVETGLRCLEKTKDQDITYICLSTAHPAKFDKAVNLALSSYSDYNFNTQVLPIEF
DGLLDEERTCIFSGKPNIDILKQIIEVTLSREKA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtctagccaagttagttatttatcgactcgtggtggatcttcaaatttttcttttgaa
gaggctgtgcttaagggtttggctaatgatggaggattgtttattccatcagaaatccct
cagctacctagcggatggattgaggcttggaaggacaaatccttccctgaaattgccttt
gaggtaatgtctttgtacattcctcgctctgaaatttcagctgatgaattgaaaaaattg
gttgatcgctcttactctaccttccgccacccagagactactcctctaaaatcattaaag
aacggtctcaatgtacttgagctcttccatggtcctacttttgcgttcaaagatgttgct
ttgcaatttcttggtaacctctttgaatttttccttactcgtaagaacggaaacaaacct
gaagacgaacgtgatcatctgaccgtggttggtgccactagtggtgacactggtagtgca
gctatctatggcttacgtggcaagaaggacgtttcagtttttatcttatttcccaatgga
cgtgtttcccctatccaagaagctcagatgactacagtcacagatcctaacgttcactgt
atcactgtgaacggcgtctttgacgattgtcaagatcttgttaaacaaatttttggcgat
gttgagtttaataagaagcatcatattggtgccgttaattctattaactgggctcgtatt
ctctctcaaattacctattacttatattcttatctttccgtttacaagcaaggaaaggct
gacgatgttcgtttcatcgttcccaccggtaattttggtgatattctcgctggttactac
gccaagcgtatgggcttacctactaaacaacttgttattgctactaacgagaatgatatt
ttgaatcgtttcttcaagactggtcgttatgaaaaagctgattctactcaagtttcgccc
agtggacctatttccgccaaagaaacttactctcctgcaatggacattttggtttcttct
aacttcgagcgttacttatggtatcttgcattagccactgaggctcctaatcatactcct
gctgaggcctcggaaattttgtctcgctggatgaatgaattcaaacgtgatggaacagtt
actgtccgtcccgaggttttggaagccgctagacgtgatttcgtgagtgaacgtgttagt
aatgatgaaaccattgatgctattaaaaaaatctatgaaagtgatcattatatcatcgac
ccacacactgctgttggcgtcgaaactggtcttcgttgcttagagaagactaaggaccag
gatattacctatatttgcctttccacagctcatcctgctaagtttgacaaagcagtaaac
cttgctctttcttcttatagtgattataactttaacacacaagtattaccgatagagttt
gatggcctcttggatgaggagcgcacctgcattttctcaggaaaacccaatattgacatt
cttaaacaaattattgaagttactctcagcagagagaaagcttag

DBGET integrated database retrieval system