KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB17E12.07cHelp
Entry
SPAPB17E12.07c    CDS       T00076                                 

Gene name
sen2
Definition
(RefSeq) tRNA-splicing endonuclease subunit catalytic subunit Sen2 (predicted)
  KO
K15322  
tRNA-splicing endonuclease subunit Sen2 [EC:3.1.27.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    SPAPB17E12.07c (sen2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PomBase: 
UniProt: 
Position
I:complement(join(1277785..1278092,1278140..1278974))
Genome map
AA seq 380 aa AA seqDB search
MSKNHEVYKDALPISLAYPLPPIILTNPLTWIPYIYRYLFRKTPRQVQWQCQLHESDLSC
VVTDSEAIKKFWTSGFFGKGNLSRSEPTWHTRTKRSLGLLGFDEDLVAEEVTARRRFQRK
QFKAQRAYRENRARERQLLLENGKPIPASLEEDAELPEYLTKSLKDFSRVSENPYHITSV
PNVEHLQLTFPEAFFLASLGVLRINYENPNFELLPILKLFANIVANSVALTHDYSLQQSH
EDPIIEPDNKFLTELAAYFYFRQQGWVVKNGTKFSVDFLLYKKGPVFSHAEFAILLIPCV
GNKQKYNMQWHEVHCLNRVIAQVKKSLILCYVQCPSIEDFNKIWKNQASMNEWDWAESVL
RQYLIRCVTLRRWVPSRNRD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaatcatgaagtttataaggatgcgctccctatttctttagcttatcctctt
cctcctattattcttactaatcctttaacctggataccatatatatatcggtacctattt
agaaagacacccaggcaagtacaatggcaatgtcagcttcatgaaagtgacctcagctgt
gttgtaacagatagtgaagctattaaaaaattttggacatcaggtttttttggaaaagga
aatttgtctcgtagcgagccaacttggcatacacgaactaagcgatcgctgggacttctt
ggatttgatgaagaccttgtagctgaggaagttaccgcgcgtaggagatttcagcgaaaa
caatttaaagcacaaagagcttatagggaaaatcgtgctcgtgagaggcaattactatta
gaaaatggcaagccgattccagcatctttagaagaagatgcagaacttcctgagtattta
acgaaatctcttaaagacttttcccgagtttccgaaaatccataccatattacttcagtg
cctaatgttgagcacctacagctaacatttccggaagccttttttttagcttctttggga
gtccttcgaatcaactacgaaaaccctaattttgaacttttacctattttaaagcttttt
gccaacatagttgctaattcagttgcccttactcatgattattctttacagcaaagccat
gaagaccctattattgagccggacaacaaatttttaactgaattggctgcttatttctac
tttcgtcagcaaggttgggttgtaaaaaacggaaccaaattttcggtggattttttattg
tacaaaaagggtccagttttcagccatgccgagtttgctattttgctaattccatgtgtt
ggaaacaaacaaaaatataacatgcaatggcatgaagttcattgtctaaatcgggtaatt
gcgcaagtgaaaaagagcctaatattatgctatgttcaatgtcctagcattgaagacttt
aataaaatatggaaaaatcaagcctcaatgaatgaatgggattgggcagagtctgtactt
cgacaatatttaattcgatgtgtaaccttaaggcgctgggttcctagcaggaatagagat
tag

DBGET integrated database retrieval system