KEGG   Schizosaccharomyces pombe (fission yeast): SPBC106.01Help
Entry
SPBC106.01        CDS       T00076                                 

Gene name
mph1, SPBC1271.16c, SPBC243.01
Definition
dual specificity protein kinase Mph1 (EC:2.7.11.1)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:spo04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:373889..375925
Genome map
AA seq 678 aa AA seqDB search
MSKRNPPVTNIADLVSDSSLDEDSLSFLEELQDPELYFKNDTFSSKSSHSDGTVTGDTLR
RQSSGATALERLVSHPRTKNFDLQGNGGQNSALKEVNTPAYQSMHHFEHLITPLPSTNAS
HSEVSLSAGVNDLNSNSEHDLLPKSVNKTPGSLSISRRRRIGRIGLGPPKRAEYTLTDPS
KTSDTKNSTEADEDIEMKSREVSPASNSVAATTLKPLQLHNTPLQTSQEHPKPSFHPSQF
ESSFSPRVQFDHDVERRASELHSRPVTVFQEPQRSASQPYESHALSPKVAPLFDNSQATP
IPKRQQDVVTVANLQFIKLGVVGKGGSSMVYRIFSPDNSRLYALKEVNFINADQTTIQGY
KNEIALLRKLSGNDRIIKLYAAEVNDTLGQLNMVMECGETDLANLLMKNMKKPINLNFIR
MYWEQMLEAVQVVHDQNIVHSDLKPANFLLVEGNLKLIDFGIAKAIGNDTTNIHRDSHIG
TINYMAPEALTDMNAHTNSGVKLVKLGRPSDVWSLGCILYQMVYGRAPFAHLKMIQAIAA
IPNEQYHIHFPEVALPANAVQEKEGSLPGVTVGPDLMDVMKRCLERDQRKRLTIPELLVH
PFLNPLPSYLTPLAKKPLPVSGHTNNAHPLRLSTEISASQLSMIIERSVELSKHKRLNKE
LIDSMAYDCVSNLRKMPE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcgcaatcctcctgtgactaatatcgcggacttggtgtcagattcttcctta
gatgaagactcgctttcttttctcgaagagcttcaggatccagaattatacttcaaaaat
gacactttctcttccaagagtagccattctgatggcaccgttactggggatacgttgcgt
aggcagtcaagcggtgcaactgctttagagagattggtctcacatcctcgtactaaaaat
tttgatttgcaaggaaatggaggacaaaattctgctttgaaggaagtgaatactccagca
tatcagtcaatgcaccatttcgagcatttaataacacccttgccctctactaatgcgtct
cacagtgaagtttcactcagtgcaggagtgaatgatctcaattctaattcggagcatgat
ttgttacctaaaagtgtaaacaaaacccccggttctttatcaatttcaagacgacgaaga
atcggcagaattggattaggccctccaaagcgtgctgagtacacgttgacggatccctcg
aagacttccgataccaaaaactctacagaagcagatgaggatattgaaatgaaatctcga
gaagtatcaccagcttccaactctgttgctgcaacaactttaaaacctctgcagctgcat
aacactcctttgcaaacatcccaggagcatcccaaaccttcttttcatccttctcagttt
gagagctctttttctcctagggtgcagtttgatcacgatgttgaaagaagagctagtgaa
cttcattctcgtccagtcaccgttttccaagagcctcagcgttctgcttctcaaccatat
gaatctcatgctctttctccaaaggtggctccgttatttgataacagtcaagctactccc
atacccaagcgtcagcaggacgttgttactgttgccaatctacaatttatcaaattagga
gttgttggaaagggtggaagtagtatggtatatcgcatattttcccccgataacagtcgt
ttatacgctttgaaagaggtgaactttattaatgcagaccaaactactatacaaggatac
aagaacgaaattgcattattaagaaagctttcaggcaatgatcgcataattaaattatat
gctgccgaagttaatgatactttagggcaactcaatatggtgatggaatgcggagaaacg
gatttagcaaaccttttaatgaaaaacatgaagaaacccattaatcttaatttcatcaga
atgtattgggagcaaatgctagaggcggtccaggtagttcatgatcaaaatatagtgcat
tcggatttgaagccggccaatttcctgcttgtagaagggaatttgaagctgattgatttt
ggcattgccaaagcaattggtaatgacaccactaatatccatcgtgattcccacatcggt
actattaattatatggcacctgaagctttgacagacatgaatgctcacacaaactctggc
gtgaaactcgtaaagttgggcaggcccagcgacgtgtggagtttgggatgtatattatat
cagatggtgtatgggagggccccgtttgctcatctaaaaatgatccaagctatagcagct
atccctaatgaacaatatcacattcatttccccgaagttgccttacctgctaatgctgtc
caggagaaagagggatcgttgccaggtgtaactgtcgggcctgatctaatggatgttatg
aaaagatgcctggaaagggatcaacggaagagacttacaataccggaattgctggttcat
ccctttttaaaccctttgccatcctatttgacacctttggccaaaaagccgttacctgtt
tctgggcacaccaataatgctcatccacttagactcagcacagaaatctcagcttctcaa
ttatcaatgattatagaaaggtcggtggagttgagtaagcacaagcgattaaataaggaa
cttattgatagcatggcttatgattgcgttagcaatttacgaaaaatgccagaatag

DBGET integrated database retrieval system