KEGG   Schizosaccharomyces pombe (fission yeast): SPBC106.09Help
Entry
SPBC106.09        CDS       T00076                                 

Gene name
cut4, apc1
Definition
anaphase-promoting complex subunit Apc1
Orthology
K03348  
anaphase-promoting complex subunit 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC106.09 (cut4)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBC106.09 (cut4)
   04113 Meiosis - yeast
    SPBC106.09 (cut4)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SPBC106.09 (cut4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:390989..395365
Genome map
AA seq 1458 aa AA seqDB search
MLELKTNVIQDPELKDSLDLQENDRVEIIGDAVHYIVNDHLNRVFNYTVDQQKIHAALIT
TFASGKKAIVVILDDIGYVYYVGDNNNDSYIINVPFSTESAWSSPSGLYLQRHRSSDENL
NTDLPHIFCLNDPLDELTLIKFDGKKILSLFDSIVYVVGEIVVTHNKKEKKLSFWRSRFI
DPESDQSIKSSRNRRRESSFSREKNPDLTRSDSIHYTANTRLSEKFEEQGLAYSTIFSHI
ESFPITGSTSFDSILGNGVLVITTLVKELEKGYMMLFRLVRDRSPYFLDSLQLHAINLSA
IKSKHLQKIVVLSSKGKVSLESPMSPSLPIEGTFRSFRVHGATLYLEDTDGVQRYISLDN
RASNSLVKWCLSVIRYVLPLREYEIFYTGHLYALFAFKLSHDEAFISSILACFTFFSRDK
VHVEPIEDCNEAYSLSSKFHFKKEILIASQLSSHLDYSTFKNYLMPLAITLHFISEELRL
DSVVKPRKDQLVALLLQITTWLKWPRYCEYYNFDIAETFLSIPLSIQVDVEEPVGPTSIL
QWIIECLRSQSTVPFYGLESYGLPHSCSTMFPQTLSLMQLLDCLLNPNMTLQNLVEEMVR
LGISRKRCERYPFGILCIIFTVLEIAAEEYSPNWESEELRLVNRLDVDSFLHPKTPKWVF
NKQDQEVKEIKALTSTVTDSTLVDTQSFHPYKVVTDMIFREDRRLAEVNKLLNYSSQITI
MTEHFDVDLSSVPMQQKVAQCICVRTLSVPIGAGMLTYGSKNPLPTEKVTPRLFNFTLHL
HPGTLIIQPNKEFVTQELTEWPEFNVGVALGLSISKFSKEINTSWIMFNRPETLTAYHAG
FLFGLGLNGHLKALATWHSFIYLTSKHDTTSIGLLLGLASSYLGSMDAKVTKLLSVHISA
LLPVGSNELNISPLTQTAGILGIGLLFHDSCHRRMSEVTMEEILASNESELKNEGYKLAA
GFSLGLINLGRGSNLPGMSDLKLVSRLQVGISSQATFQSLEAGSPGAIMALTMIYMKTND
LEVAKKIDIPKSRYLLDFYRPDLILLRVAGKNLIMWDEVKADYEWVKYQIPDIMLSQFDL
QEKKVLSSDDLLLYNVLAGICFSLGLRFAGTGNPKAKEILINFLDSFIRLCHLPAKTHDE
RVTAVTVIRCTQIVALSSSCVMAGYCDLDVLRRLRVLHGRMEPVNYGAQMATHMALGILS
LGGGRYSLSRSNLAIAALLISFYPQFPRTTQDNRAHLQAARNLWALAVEERCIIPRNQDT
KQPCIVPLNVVQKSGAVQKLEAPILLPPYDSISSVSTLGDKYWNLKIDLDNNSDYRELLR
ESQTLTLMPYDRTSSKEEPLNLFPKLKDTSSPLWNLVKTSRLFQSSNSPLNVASLQESNN
KTSLGVKLLLSMDFDNLTRDRLLSLQILLQFFESCWTGVLLNKFHSRQYLFLSRDLVEDL
SLRVWEYVYSHNHNEESV
NT seq 4377 nt NT seq  +upstreamnt  +downstreamnt
atgctagaattaaaaacaaatgttattcaagaccctgaattaaaggattcattagatttg
caagagaatgatcgggttgaaatcattggagatgctgtgcattatattgtgaatgaccat
ttaaatcgtgtatttaattataccgtagatcaacaaaagatacatgctgcccttattact
acatttgcatctggaaaaaaggcaattgttgtgattctggacgacattggatatgtatac
tatgtgggcgacaataataatgattcttatattataaacgttcctttttcaacagaaagc
gcatggagttcaccaagtggactatatcttcagcgtcatcgttcgagcgatgagaatctg
aatactgacttgcctcatattttttgtctaaacgatcctttagatgaacttacgttaata
aaatttgacggaaaaaaaatactatctctgtttgattcaatcgtttatgtcgtgggagag
atcgtcgtaacacataataaaaaagaaaaaaaattgagtttttggaggagtcgctttatt
gatccagagtcagaccagtcaataaaaagctcacgtaacagaagaagggaaagctctttt
tctcgtgaaaagaatcctgacttaactcgctctgattctatccattataccgccaatact
cgtctttctgaaaaattcgaggaacaaggactcgcttattcgaccatattttctcacata
gagtcttttcctatcaccggaagtacttcgtttgattcaatccttggaaatggtgttttg
gtcatcaccactttagtgaaagagcttgaaaaaggctacatgatgttgtttcgccttgtt
cgtgacagatctccttacttcttagattcgcttcaactacatgcaataaatttgagtgct
attaaatctaagcatttgcaaaaaattgttgttctgtcttcaaaggggaaggtgagtctc
gagtctccaatgtcgccatctttgcctattgagggtacctttcgttcatttcgtgtgcat
ggtgccacactttacttagaggacaccgatggagtgcagaggtatatatctctagataac
agagcatccaatagcttggtaaaatggtgtttaagtgttattcgttatgttttgcccttg
cgtgaatatgaaattttttatactggacatctttacgcgctttttgcttttaagcttagc
catgatgaggctttcatatcttcaatactcgcctgtttcactttcttttctcgagataaa
gttcatgttgaaccaattgaagattgcaatgaagcttacagtctgtcctctaagtttcat
tttaaaaaagaaatacttattgcttctcagctctcatctcatcttgattactcaacattc
aaaaattacttgatgcccttagctattaccttacattttatatctgaagaattgcggttg
gattcggttgtaaagcctcgtaaagatcagcttgtagctttattacttcaaatcaccacg
tggttgaagtggccacggtattgcgagtattataactttgatatcgctgaaacatttcta
tctatacccttatcgattcaagttgatgttgaggaacctgttggtccaacatcgatttta
cagtggattattgaatgtttaaggtcgcaatctacagtacctttttatggcttggaaagt
tatgggctaccacattcttgctctactatgtttccccaaaccctttctttaatgcagtta
ctcgattgcttgctaaatcctaatatgacccttcaaaacttagttgaagaaatggtacgg
ttaggaatttcaagaaagaggtgtgaaagatacccatttggaattttatgcattattttt
acagtactcgagattgccgctgaagagtattctccgaattgggaaagcgaagagcttcga
ttagtcaatcgccttgacgttgattcattcttacatccaaagacacctaaatgggttttt
aataagcaggatcaagaagtcaaagaaataaaagcactcactagtacagttaccgattct
acacttgttgacacgcagtcgtttcatccttataaggttgtaacggatatgatttttaga
gaggatcgacgactggcagaagtgaataaacttttaaattattcaagtcaaatcaccata
atgactgaacactttgatgtcgacttgagttcagtaccaatgcaacaaaaagttgctcaa
tgcatttgcgttagaacattgtccgtgccaattggagcgggtatgcttacgtatggtagt
aaaaatcctttacctacggaaaaggtcactccacgattatttaattttacattgcacttg
catcctggaactttaattatacaacctaataaagagttcgtaacacaggaattaaccgag
tggccagagtttaatgttggcgttgcattaggattatcgatatctaagttttcaaaggaa
ataaacactagttggattatgttcaatcgacctgaaactttgactgcttaccatgcggga
tttctttttggtctagggctaaacggtcatttaaaggcccttgctacctggcattctttt
atttatcttactagcaagcatgatacaaccagtataggccttttacttggacttgcatcc
tcgtatttggggagtatggatgcaaaggttacaaaattgctaagtgtgcacatttcagca
ttactgccagttggatctaatgaattgaatatttcaccattaactcagactgcaggaatt
ctaggaattggtttattatttcatgattcgtgtcatagacgcatgtctgaagtgaccatg
gaagagattttggcttctaatgaaagcgaactaaagaatgaaggctataagttagctgct
ggattttctcttggtttaattaatttagggagaggatctaatcttccaggcatgtctgat
ttaaaactcgtttcaaggctacaagtgggaatatctagtcaggctacatttcagtcttta
gaagccggttctcccggggccattatggctttgactatgatatatatgaagactaatgat
ttggaagttgcgaaaaaaattgatattcctaaatcgcgatatcttcttgatttctatcgt
ccagatctaatacttttgcgagttgccggtaaaaacttaattatgtgggatgaagtcaaa
gcagattatgaatgggtgaaatatcaaattcctgatataatgctctcacaatttgattta
caggaaaaaaaggttctctcttctgacgacttgctgctttataatgtcttagcagggatt
tgtttttctttaggtttaaggtttgctggaacgggtaatccgaaagccaaggaaattctc
atcaactttttagatagcttcattcggttgtgtcatctgcctgctaaaacacacgatgaa
agagtaactgcagtgactgtaattcgctgtacacaaattgtcgctttgtcttcttcttgt
gttatggcgggttattgtgatctagatgttttgagaaggttaagagtactacatgggaga
atggagcctgtgaactacggggctcaaatggctactcatatggcgctcggaattctttcg
ctaggtggaggaaggtatagtttgtctcgcagtaatttagcaatcgcggctttgttaata
tcattttatccgcaatttcccaggactactcaagataatcgtgcacatttgcaagctgct
cgaaatttgtgggctttagctgtggaagaacgttgtattatcccgagaaatcaagatacc
aaacagccatgcatagtgccattaaatgttgttcaaaaaagcggcgcagttcaaaaacta
gaagcgcctatacttttgccgccgtacgatagcattagttcagtgtcgacgttgggtgat
aagtattggaatttaaaaattgatttggacaataacagtgattaccgtgaactattaagg
gaatcacaaacactgacactgatgccttatgaccgaacaagttcaaaagaagagccactt
aatctattccctaagcttaaagatacctcaagcccactttggaacttggtaaaaacaagc
aggttgttccaaagctcgaatagccccttaaacgttgcatcgttacaagaatcaaataat
aaaacttctctaggcgttaaattactcctgtctatggactttgataatttaactagagac
cgtttattaagtttgcaaatactgttacaattttttgagtcttgttggactggtgtgctc
ttgaataagtttcactcccgtcaatatcttttcctttctcgtgatttggtagaagatttg
agtttgagagtatgggagtatgtgtattctcataatcataatgaagaatctgtataa

DBGET integrated database retrieval system