KEGG   Schizosaccharomyces pombe (fission yeast): SPBC106.10Help
Entry
SPBC106.10        CDS       T00076                                 

Gene name
pka1, git6, tpk
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit Pka1 (EC:2.7.11.1)
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SPBC106.10 (pka1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SPBC106.10 (pka1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   SPBC106.10 (pka1)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SPBC106.10 (pka1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:396992..398530
Genome map
AA seq 512 aa AA seqDB search
MDTTAVASKGSTNVGSSTDTLSTSASLHPSMNAGSVNEYSEQQRHGTNSFNGKPSVHDSV
GSDASVSNGHNNHNESSLWTSGIPKALEEATKSKKPDSLVSTSTSGCASAHSVGYQNIDN
LIPSPLPESASRSSSQSSHQRHSRDGRGELGSEHGERRSAMDGLRDRHIRKVRVSQLLDL
QRRRIRPADHTTKDRYGIQDFNFLQTLGTGSFGRVHLVQSNHNRLYYAIKVLEKKKIVDM
KQIEHTCDERYILSRVQHPFITILWGTFQDAKNLFMVMDFAEGGELFSLLRKCHRFPEKV
AKFYAAEVILALDYLHHNQIVYRDLKPENLLLDRFGHLKIVDFGFAKRVSTSNCCTLCGT
PDYLAPEIISLKPYNKAADWWSLGILIFEMLAGYPPFYSENPMKLYENILEGKVNYPSYF
SPASIDLLSHLLQRDITCRYGNLKDGSMDIIMHPWFRDISWDKILTRKIEVPYVPPIQAG
MGDSSQFDAYADVATDYGTSEDPEFTSIFKDF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatacgactgccgttgcttccaaaggaagtactaacgtgggttcttcaactgacact
ctatctacaagtgcctctttgcatccatctatgaatgccggcagcgttaatgaatattcg
gaacagcagcgacatggaacaaattcttttaatggcaaaccctctgttcatgattctgtt
ggtagtgatgcaagtgtaagcaatggtcataataaccataatgaatcaagtctgtggact
tcgggcatccctaaagctttggaagaggccacgaaaagcaaaaaacccgacagcttggtt
agcaccagtacgtctggctgtgcaagtgcccattctgttggttaccaaaacatcgataat
ttgatcccttcacctcttcctgaaagcgcgagtagaagtagtagccaaagcagccatcaa
agacattcgcgggacggtcgtggtgaactaggttcagaacacggagagagacggtcagct
atggatgggctacgcgatcgccatattcgtaaagttcgggttagtcagctgctcgattta
cagcgtcgaaggattcgtcctgctgaccacaccacaaaagatcgatatggaatacaagat
ttcaatttcttacaaacattgggcactggctcgtttggtcgagttcatctcgttcagtcg
aatcacaatcgcctgtattacgccatcaaggttttagaaaagaaaaaaatcgttgatatg
aagcaaatagagcacacttgcgatgagagatacattttatcccgtgtccaacacccgttc
attaccattctatggggtactttccaagatgccaaaaatctgtttatggtcatggatttt
gctgaaggaggagagcttttttctttgcttcgtaaatgtcatcgatttcccgaaaaagtt
gccaaattttatgcagcagaagtgatccttgctcttgattatcttcaccacaatcaaatc
gtatatcgagatttaaaacccgaaaatcttcttcttgaccggtttggtcatttgaaaatt
gtggactttggttttgccaaacgcgtctctactagcaactgttgtactctttgtggtacc
cccgattatttagccccggaaatcatatctttaaaaccgtacaacaaagctgcagattgg
tggtcccttggtattcttatctttgaaatgcttgcgggttatcctccattttactctgag
aatccaatgaagttgtatgagaatatccttgaaggcaaggtcaactatccatcgtacttt
tctcctgctagtattgatttgttgagccatttacttcagcgagacataacctgccgctat
ggaaatttgaaagatggtagcatggatattattatgcacccttggttccgtgatatcagc
tgggacaagatccttactcggaaaattgaggttccgtatgttcctcccattcaagctgga
atgggtgattccagtcaatttgacgcttatgctgatgtagctacggattatggaacatct
gaagatcctgaatttacttctatctttaaggacttttga

DBGET integrated database retrieval system