KEGG   Schizosaccharomyces pombe (fission yeast): SPBC106.10Help
Entry
SPBC106.10        CDS       T00076                                 

Gene name
pka1, git6, tpk
Definition
cAMP-dependent protein kinase catalytic subunit Pka1 (EC:2.7.11.1)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SPBC106.10 (pka1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SPBC106.10 (pka1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   SPBC106.10 (pka1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:396992..398530
Genome map
AA seq 512 aa AA seqDB search
MDTTAVASKGSTNVGSSTDTLSTSASLHPSMNAGSVNEYSEQQRHGTNSFNGKPSVHDSV
GSDASVSNGHNNHNESSLWTSGIPKALEEATKSKKPDSLVSTSTSGCASAHSVGYQNIDN
LIPSPLPESASRSSSQSSHQRHSRDGRGELGSEHGERRSAMDGLRDRHIRKVRVSQLLDL
QRRRIRPADHTTKDRYGIQDFNFLQTLGTGSFGRVHLVQSNHNRLYYAIKVLEKKKIVDM
KQIEHTCDERYILSRVQHPFITILWGTFQDAKNLFMVMDFAEGGELFSLLRKCHRFPEKV
AKFYAAEVILALDYLHHNQIVYRDLKPENLLLDRFGHLKIVDFGFAKRVSTSNCCTLCGT
PDYLAPEIISLKPYNKAADWWSLGILIFEMLAGYPPFYSENPMKLYENILEGKVNYPSYF
SPASIDLLSHLLQRDITCRYGNLKDGSMDIIMHPWFRDISWDKILTRKIEVPYVPPIQAG
MGDSSQFDAYADVATDYGTSEDPEFTSIFKDF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggatacgactgccgttgcttccaaaggaagtactaacgtgggttcttcaactgacact
ctatctacaagtgcctctttgcatccatctatgaatgccggcagcgttaatgaatattcg
gaacagcagcgacatggaacaaattcttttaatggcaaaccctctgttcatgattctgtt
ggtagtgatgcaagtgtaagcaatggtcataataaccataatgaatcaagtctgtggact
tcgggcatccctaaagctttggaagaggccacgaaaagcaaaaaacccgacagcttggtt
agcaccagtacgtctggctgtgcaagtgcccattctgttggttaccaaaacatcgataat
ttgatcccttcacctcttcctgaaagcgcgagtagaagtagtagccaaagcagccatcaa
agacattcgcgggacggtcgtggtgaactaggttcagaacacggagagagacggtcagct
atggatgggctacgcgatcgccatattcgtaaagttcgggttagtcagctgctcgattta
cagcgtcgaaggattcgtcctgctgaccacaccacaaaagatcgatatggaatacaagat
ttcaatttcttacaaacattgggcactggctcgtttggtcgagttcatctcgttcagtcg
aatcacaatcgcctgtattacgccatcaaggttttagaaaagaaaaaaatcgttgatatg
aagcaaatagagcacacttgcgatgagagatacattttatcccgtgtccaacacccgttc
attaccattctatggggtactttccaagatgccaaaaatctgtttatggtcatggatttt
gctgaaggaggagagcttttttctttgcttcgtaaatgtcatcgatttcccgaaaaagtt
gccaaattttatgcagcagaagtgatccttgctcttgattatcttcaccacaatcaaatc
gtatatcgagatttaaaacccgaaaatcttcttcttgaccggtttggtcatttgaaaatt
gtggactttggttttgccaaacgcgtctctactagcaactgttgtactctttgtggtacc
cccgattatttagccccggaaatcatatctttaaaaccgtacaacaaagctgcagattgg
tggtcccttggtattcttatctttgaaatgcttgcgggttatcctccattttactctgag
aatccaatgaagttgtatgagaatatccttgaaggcaaggtcaactatccatcgtacttt
tctcctgctagtattgatttgttgagccatttacttcagcgagacataacctgccgctat
ggaaatttgaaagatggtagcatggatattattatgcacccttggttccgtgatatcagc
tgggacaagatccttactcggaaaattgaggttccgtatgttcctcccattcaagctgga
atgggtgattccagtcaatttgacgcttatgctgatgtagctacggattatggaacatct
gaagatcctgaatttacttctatctttaaggacttttga

DBGET integrated database retrieval system