KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1105.09Help
Entry
SPBC1105.09       CDS       T00076                                 

Gene name
ubc15
Definition
ubiquitin conjugating enzyme Ubc15 (EC:6.3.2.19)
Orthology
K10575  
ubiquitin-conjugating enzyme E2 G1 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC1105.09 (ubc15)
   04120 Ubiquitin mediated proteolysis
    SPBC1105.09 (ubc15)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPBC1105.09 (ubc15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(3522875..3522919,3523002..3523145,3523224..3523253,3523330..3523555,3523626..3523684)
Genome map
AA seq 167 aa AA seqDB search
MPSSASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLS
FPQDYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETI
LISVISMLSSPNDESPANIDAAKEFRENPQEFKKRVRRLVRRSIEMI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttctgctagtgaacaacttcttcgaaaacaactaaaggaaattcaaaaaaat
cctccacagggttttagcgttggtttagtcgatgataaatccatttttgaatgggaagtt
atgatcattggaccagaagatacattatatgaaggtggttttttccatgcaacattatcg
tttcctcaagattatcctctgatgcctccaaagatgaagttcacaacggaaatttggcac
cctaatgttcatccgaatggcgaagtttgcatatcgattcttcacccaccaggagatgac
aagtatggatacgaggatgctggagaacgttggcttccggtacactctccggaaaccata
ttgattagtgtaatttccatgctttcttcccctaatgatgagtcccctgccaatatagat
gctgccaaggaatttcgagaaaatccacaagaatttaagaaaagagttcgtcgacttgtt
cgcaggtcaattgaaatgatttga

DBGET integrated database retrieval system