KEGG   Schizosaccharomyces pombe (fission yeast): SPBC119.02Help
Entry
SPBC119.02        CDS       T00076                                 

Gene name
ubc4
Definition
ubiquitin conjugating enzyme Ubc4 (EC:6.3.2.19)
Orthology
K06689  
ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC119.02 (ubc4)
   04120 Ubiquitin mediated proteolysis
    SPBC119.02 (ubc4)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPBC119.02 (ubc4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:join(715333..715452,715532..715609,715981..716226)
Genome map
AA seq 147 aa AA seqDB search
MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDY
PFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHVYKTDRSRYELSAREWTRKYAI
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaaaagaattaaccgtgaattagctgatcttggaaaagacccaccgtcttct
tgttccgccggccctgttggcgatgatttattccattggcaagctacaatcatgggtcct
gctgacagcccttatgcgggtggtgtcttcttcttgtccattcatttccctacggactac
ccattcaagccaccaaaggtaaactttacaaccagaatctatcatcccaacatcaattca
aacggtagcatttgtttggatatccttcgtgaccaatggtctccagcgttgactatatca
aaggtattactgtctatctgctcattgttgacagatcctaatcctgatgatccgcttgtg
cctgaaattgcgcacgtctacaaaactgacagatcccgttatgaattaagtgctcgtgaa
tggactagaaaatacgcaatctag

DBGET integrated database retrieval system