KEGG   Schizosaccharomyces pombe (fission yeast): SPBC119.08Help
Entry
SPBC119.08        CDS       T00076                                 

Gene name
pmk1, spm1
Definition
MAP kinase Pmk1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SPBC119.08 (pmk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SPBC119.08 (pmk1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   SPBC119.08 (pmk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(730860..730925,731026..731205,731479..731550,731633..732583)
Genome map
AA seq 422 aa AA seqDB search
MDRRHRVYRVFNQEMYVEPNFKVVKELGQGAYGIVCAARNVASKDQEAVAIKKITNVFSK
SILTKRALREIKLLIHFRNHRNITCIYDLDIINPYNFNEVYIYEELMEADLNAIIKSGQP
LTDAHFQSFIYQILCGLKYIHSANVIHRDLKPGNLLVNADCELKICDFGLARGCSENPEE
NPGFMTEYVATRWYRAPEIMLSFSSYHKGIDVWSVGCILAELLGGTPLFKGKDFVHQLNL
ILHQLGTPDEETLSHISSSRAQEYVRSLPKQRPIPFETNFPKANPLALDLLAKLLAFDPN
RRISVDDALEHPYLAVWHDPSDEPVCDSVFDFSFEYIEDANELRRVILDEVLNFRQKVRR
RSHPTNPTVNIPQPAQTVPSNDNGSFNVSSSSSSQTSNKKRHDHSYNETAAIDHKSDDNR
HN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtcgacatcgtgtttaccgtgtgtttaaccaggagatgtatgtcgagcctaat
tttaaggtagtgaaggagttgggtcaaggcgcttacggcattgtttgtgcagcaagaaac
gtggctagcaaagatcaagaggctgtagccataaaaaaaattacgaatgtgttttctaaa
tccattcttacaaaaagagctttgagagagataaaactgctgattcattttcgtaatcat
cgtaacattacttgcatttacgatctcgacattataaatccatacaattttaatgaagtt
tacatttacgaagagttgatggaggccgatttgaatgctattattaaatccggtcagcca
ttaacggatgcgcattttcaatcattcatttaccagatactttgtggtttaaagtatatt
cattctgccaacgttattcatcgtgacttaaagccaggtaatcttttagttaacgctgat
tgtgagctgaaaatttgcgattttggcctcgctcgcggatgttctgaaaatccagaagaa
aatcctggttttatgacggagtatgtggcaacgcgctggtacagagctccggaaattatg
ctttcgttcagcagctatcataaaggtattgatgtttggagtgttggttgcattttggca
gagctattaggtggaacccctttgtttaagggaaaagattttgttcatcagttaaattta
attttgcatcaacttggcacacctgatgaggaaaccctgtctcatataagcagttcccgt
gcacaggagtatgttcgaagcttgccaaagcaaagacctattccttttgaaaccaatttt
cctaaagccaatcctttggctcttgacctgcttgctaagctcttggctttcgaccccaac
agacgtatttcggttgacgatgctttagaacatccctatttagctgtttggcatgatccc
tctgacgaacctgtgtgtgattccgtctttgatttcagctttgaatacattgaggatgca
aatgagttacgccgtgtcattttagatgaagttttaaacttccgtcagaaagtccgacgc
cgctctcatccaacaaacccaacagtcaacatcccgcaaccagcccaaaccgttccatct
aatgacaatggttctttcaatgttagtagctcttcatcctctcaaacctctaacaaaaag
cgccatgatcattcttataatgaaactgctgctatagaccataagtctgatgataatcgc
cataactaa

DBGET integrated database retrieval system