KEGG   Schizosaccharomyces pombe (fission yeast): SPBC119.10Help
Entry
SPBC119.10        CDS       T00076                                 

Gene name
asn1
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBC119.10 (asn1)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SPBC119.10 (asn1)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C44
   SPBC119.10 (asn1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:735416..737089
Genome map
AA seq 557 aa AA seqDB search
MCGILAVHHVAEDIEAFKPKALHLSKQLRHRGPDWSGKAIRNQTILCHERLAIVGVESGA
QPLVSDDGKLVLTVNGEIYNHLKLRENLKGNYKFKTYSDCEVILYLYREHGPACANMLDG
MFSWVLYDQDKDKVVAARDPIGITTLYQGFSSDSPDTAYFASELKALHPVCDKIIAFPPG
HYYDSETKQTVRYFKPSWWDENKIPSNPVDYKLLRETLEASVRKRLMAEVPYGVLLSGGL
DSSLIASIAARETEKLANSTSQSEEARTITAWPKLHSFAIGLPGSPDLLAARKVADFLHT
FHHEHTFTIDEGLDALRDVIYHLETYDVTTIRASTPMYLLSRKIKAQGVKMVLSGEGSDE
IFGGYLYFGNAPSREAFHSECVRRVKNLHLSDCLRANKSTMAWGLEARVPFLDKDFLEVA
LNIDPEEKMYINGRKEKYILRKAFDTTHDSSLQPYLPQDILWRQKEQFSDGVGYSWIDAL
KDTAELCISDDEFALPRREWGDDIPTTKEAFWYRKLFDEIFPRQCADTVMRWVPKAEWGC
PEDPSGRYQAGHVAALK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattcttgctgttcatcacgtcgccgaagatattgaggctttcaagcccaag
gctcttcatttgtcgaaacaacttcgtcaccgtggtcctgactggtctggtaaggctatt
cgcaaccaaactattctttgccatgagcgtcttgctattgtcggtgttgaaagtggtgct
caacctcttgtatctgacgatggtaaacttgtccttactgtcaacggtgaaatctataac
catcttaagcttcgcgaaaacttaaagggtaactataaattcaagacttactccgattgt
gaagtcattttatatctctaccgcgaacatggtcctgcttgcgctaacatgttggacggt
atgttttcttgggttttatatgatcaagacaaggataaggttgttgctgctcgtgatccc
attggtattacaactttatatcagggcttctcatctgacagtcctgatactgcctatttt
gcttctgaattgaaggcattgcatcctgtttgcgacaaaatcattgctttccctcccgga
cattattacgactccgaaaccaagcaaactgtccgctatttcaagcctagctggtgggac
gaaaataaaattccttccaaccccgttgactacaagcttctgcgcgagactttggaggct
tccgttcgcaagcgtttaatggctgaagttccttatggtgttcttctatctggtggtttg
gattccagtttgattgcttctattgccgctcgtgaaactgagaagctcgctaacagcact
tcgcagtccgaagaggctcgtaccattaccgcttggcctaagcttcattcttttgcaatt
ggtttacctggctctcctgacttgcttgcggctcgtaaggttgccgactttttgcatact
ttccatcatgagcacaccttcactatcgatgaaggtcttgatgctcttcgtgacgttatt
taccatcttgagacatatgatgttaccactatccgtgcaagtacccccatgtatctacta
tctcgtaaaatcaaggctcaaggtgttaaaatggttttgtctggtgagggatctgacgaa
atctttggtggttatttatatttcggtaatgccccctctcgtgaggccttccattccgag
tgtgtgcgtcgtgttaagaacttgcacttatccgattgcttgcgtgctaacaagtcaact
atggcttggggtcttgaggctcgtgttcctttcttggataaggactttttggaagttgct
cttaacattgatcctgaggagaaaatgtatattaacggtcgtaaagaaaaatatattctt
cgcaaggcttttgacacaactcatgattcttcattacaaccatatctccctcaagatatt
ctttggagacagaaggaacagttctctgatggcgttggttattcatggattgacgctttg
aaggacactgctgagttatgtatttcagatgatgaatttgctcttccaaggagggaatgg
ggtgacgatattcctaccaccaaagaggcattctggtaccgcaagcttttcgacgaaatc
ttccctagacagtgtgctgacactgttatgcgttgggttcccaaggctgaatggggttgc
cccgaagatccatctggtcgttaccaggctggtcacgttgctgctttaaaataa

DBGET integrated database retrieval system