KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1348.10cHelp
Entry
SPBC1348.10c      CDS       T00076                                 

Definition
phospholipase (predicted)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(26287..26355,26420..28372))
Genome map
AA seq 673 aa AA seqDB search
MYVNYIGLFAFVQISLTLAYPPGRVEISEIYDFEESSSYKGQDIDTSVLYTLSKRKPALV
KRSTDASYAPFNVTCSNDNLLRPASEGLNEGEQSYINKRISKVNSELRSFISKTGLNVDL
DKVVNSSDGPRLGIAFSGGGLRAMVNGGGAFNAFDSRFESDSPLSGLLQSAMYISGLSGG
SWLVGSVAINNFTNITYLRDNVWNLEHSVFAPHGDNVIENLNYYNDLRKEIDQKKHAGFD
CSLTDLWGRALSRKLVDAERGGPGITYSSMRNQSWFQNADYPYPIIVADSRLEEETAIPA
NTSIFEFTAYEFGTWDNGIKAFIPMEYVGTHLLDGVPPDKSCIHNYDNAGFVMGTSATLF
NSFLLDWNENVKKNDTYYDILHAILEDLSKHQDDIAPYPNPYQNYTTSNTSVVNAFEPYD
TIDLVDGGEDRENIPLWPLLHPQRFVDVVFAIDSTYNDPYGWPLGSSIVATYERVVTFNA
NKSVDVRGFPYIPDENTIISLGLNTRPTFFGCDGKNTTAGNHDVDNNTPPLLVYFPNYPW
TYYSNISTFTMSMDDKMANGILENAFMSTTQNNNESFAVCLACAIIQRSLERKKLSTPTQ
CSSCFQEYCWDGTLATSTASVYDPTVMSAATTSRAPSGTTSGTASSTTSSSVASATPTHK
HWWDSIFEAKENP
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtcaactatattggactctttgctttcgttcaaatttcgttgacgttagcttat
cctcccggtcgtgtggagatttctgaaatatatgattttgaagaatctagttcgtataaa
ggacaagatattgatacatccgtactttacactttgtctaaaaggaaacctgcgctcgta
aaacgaagtaccgacgcttcgtatgcccctttcaatgtgacctgttcaaacgacaatctg
ttgaggccggcttctgaaggtttaaatgagggcgaacagagctatatcaacaaacgtatt
tctaaggttaacagtgaactccgatcatttatttctaagacaggtttgaatgttgacttg
gataaggtggttaacagctcggatggtccacgtttaggaattgcattctcaggtggtggg
ttacgggcgatggttaatggaggtggtgcattcaatgcttttgactcaagattcgagagt
gactctccactttctggtctgctgcaatccgcgatgtatatcagcggtctttctggtggt
tcatggcttgttggatcagtggctattaataattttacgaatataacatacttacgtgat
aatgtctggaatttggaacatagcgtttttgctcctcatggggataatgtcattgaaaat
ttgaattattataatgacttgcgcaaagaaattgatcaaaagaaacatgcgggctttgac
tgttctttgacggatttatggggacgtgctttgtcccgtaaacttgttgatgctgaaagg
ggaggaccaggcattacatattccagtatgagaaatcaaagctggtttcaaaatgctgat
tatccttatcccatcatcgttgcggatagccgattagaagaagaaacggccatccctgcc
aataccagtatctttgagttcacggcgtatgaatttggtacatgggacaatggaattaaa
gcattcattccaatggaatatgtgggaactcacttgttggatggggttccacccgataag
tcttgcattcataactatgataatgcaggttttgttatgggcacttcagctactttattc
aactcttttcttcttgactggaatgaaaatgtcaaaaagaatgatacctattacgatatt
cttcatgcgattcttgaagatctttctaagcatcaagatgatattgctccttatcccaat
ccttaccaaaattatactacttccaatacctctgtagtgaatgcgttcgaaccgtatgat
actattgatctagttgatggtggtgaggatagggaaaacattcccctttggcctttgtta
cacccacaacgatttgtggacgttgtatttgcgattgattcgacttataatgatccttat
ggttggccccttggatcttccattgttgctacatatgagagagttgtaacctttaatgcg
aacaagagtgttgatgtgcgtggatttccatatattccggacgaaaacactattatctct
ttgggactaaacactcgtcctacgttttttggatgtgacggtaaaaatactacagcagga
aatcatgatgtagacaataataccccacctctccttgtatactttccaaattacccttgg
acttattattccaatatatcgacatttactatgagcatggacgacaagatggctaatgga
attcttgagaatgcatttatgtcgactacgcaaaacaataatgaatcttttgcagtttgc
ttagcatgcgctataattcaacgctctttggaacgcaagaaattgagtactcctacccag
tgctcttcttgtttccaagaatactgttgggacggaactcttgcaactagtacggcttct
gtatatgatcctaccgtaatgtctgctgcgacaacatctcgtgcaccgtcaggcacaacc
tcgggtacagcctctagtacaacatcttcatctgtagcatcagccactcccactcataaa
cattggtgggactcgattttcgaagcgaaagaaaatccgtaa

DBGET integrated database retrieval system