KEGG   Schizosaccharomyces pombe (fission yeast): SPBC13G1.13Help
Entry
SPBC13G1.13       CDS       T00076                                 

Gene name
tfb2, SPBC31F10.01
Definition
transcription factor TFIIH complex subunit Tfb2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SPBC13G1.13 (tfb2)
  Replication and repair
   03420 Nucleotide excision repair
    SPBC13G1.13 (tfb2)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBC13G1.13 (tfb2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(3754070..3754392,3754438..3755458)
Genome map
AA seq 447 aa AA seqDB search
MQAEFKSSINDFLEQLPNHARLYQKPAACLAVFRLLPILARQYVMSMLFNPMPVALSDFD
LWIKLSSKVYQSESFNKLVRMHIFQFDGQYITLNSEFRKQFITALTGGGNHNSFGVPCTD
EDKHLVTVDFLDAYAKETWETILHFMVGTPEAKFPGEGVLSLLKRGGLMSGPKNQLRITR
AGFQFLLQDINAQIWTLLLDYLKLSEDTHMDPVQVLHFLFMLGSLDLGRAYSVDFLTDTQ
QIMLEDLREYGLVYQRKITSKRFYPTRLATGLTTDYRSLHGKQSENDDDKGFIIVETNYR
LYAYTSSPLQIAIIGLFANLRARFSNLVVGVITRDSIRRALMNGIAAEQIITYLTTHAHP
QMRSNVPLLPPTLVDQIYLWELEKNRLRATPGILFRDFLTDSGFDQAVEYAKELGVLVWD
SSLKRMFFITTTGAQPMIAYLKRRAVK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagaattcaagtctagtatcaacgacttcctggaacagttaccaaatcatgca
aggctttaccaaaagccagctgcttgtcttgctgtgtttcgtttattgccaattctagct
agacagtatgtcatgtctatgcttttcaatcctatgccagtagcactctcagatttcgat
ttatggatcaaactttcgagtaaagtttatcaatctgaatccttcaacaaactggttagg
atgcatatatttcaatttgatggacaatatatcactctaaatagtgaatttcgcaaacaa
tttataactgctctgactggaggaggaaatcacaattcgtttggcgtgccatgtaccgat
gaagacaagcacttggtgacggttgattttcttgacgcatatgcgaaagaaacttgggaa
acaatcttgcacttcatggtaggaactccggaagctaaatttcctggagaaggtgtctta
agtctattaaagcggggcggtttaatgtctggtccaaaaaaccagctacgtattacccgt
gccggttttcagtttctgttacaggatataaatgctcaaatttggacgttacttttggat
tatttaaaactatctgaagacacgcatatggatcctgttcaggttttgcactttttattt
atgcttggaagtttggatttggggagggcatactcagtggacttcttaacagatacacaa
caaatcatgcttgaagacctaagagaatatggattagtttatcaaagaaaaattacttcc
aagcgtttctatccaaccagactggcaacaggtctgacaactgattatcgctcattgcat
ggaaagcaaagtgaaaatgatgatgataaaggttttattattgtagaaacaaattaccga
ttatatgcttacacaagctccccattacagattgccatcatcggattgtttgctaactta
agggcgcgtttttcaaatcttgttgtcggtgtgataactcgggatagtattcgtcgtgct
ttgatgaatggaattgcagcggagcaaattattacatacttgacaactcatgctcaccct
cagatgagatcgaatgttcctcttttacctcctacattagtagatcaaatttatttatgg
gaattggaaaaaaatagacttcgggctactcctggaattttgtttcgcgattttcttact
gattctggcttcgaccaagcagtagagtacgcaaaagaactcggggttttggtttgggac
agttccttgaaaagaatgtttttcataactacgacaggcgcccagcccatgatcgcatac
ttgaaaagacgagctgtcaaatga

DBGET integrated database retrieval system