KEGG   Schizosaccharomyces pombe (fission yeast): SPBC14C8.05cHelp
Entry
SPBC14C8.05c      CDS       T00076                                 

Gene name
meu17
Definition
glucan-alpha-1,4-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPBC14C8.05c (meu17)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SPBC14C8.05c (meu17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(2212020..2213372)
Genome map
AA seq 450 aa AA seqDB search
MRTYWLFLLLGGVVSAESLLSPNKRSKEASMDEWTDQQKGIAMGHMLNNIGDSGMHAKDI
NPGCIIASPSTDSPDYYYQWVRDSALTIMTILDRFFEGDKGLEPIIVKYMDEMVRLQKVP
NPSGDFYAGGLGEPKFNVDGTSYDGDWGRPQNDSPALRAIAFIKYMNYLFENGKEVHEVT
VWIEAVLADLDYTANHWTEASFDLWEEIKDVHYFTLAVQKRAMQDGTAFAKRIGAPDQAA
LYQRTIEPIDLKLGEFWDPGMGVIKGYKGRVDRSGLDCSTLLASLYSNEFDMHILPTLLK
LQETMTRDYPVNQGWKQAMGRYPEDVYDGVSKSIGNPWFICTSSAAEIIYKAIAYYDNKG
LPELTEYNIHFFMKFAEFGDPYNWSVIRKNMHTYADNFLKAVAEFQHPNGSMSEQFSRDD
GHQKGARDLTWSYSSLLNAIYRREAIKGSV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacatactggttattcttactccttgggggggtcgtatctgcagaaagcttactt
tcccctaataaaagaagcaaggaagcttctatggatgaatggacggatcagcaaaagggt
attgctatgggacatatgctgaacaatatcggtgacagcggtatgcatgctaaggatatt
aatcctggatgtattattgcttccccttcaactgattcccctgattactattatcaatgg
gttcgtgatagtgcattgacgatcatgactattttagatcgtttctttgaaggggacaaa
ggacttgagccgattatcgtcaaatatatggatgaaatggtcaggctccaaaaggtcccg
aacccaagtggagacttttacgccggaggtcttggtgagcctaaatttaatgttgatggg
acaagctatgacggagattggggacgtccccagaatgattcccctgctcttcgggctatt
gcatttatcaaatacatgaattatttatttgaaaatggtaaagaggtccatgaagttact
gtctggattgaggctgtattagccgacttggattatactgcaaatcactggacagaggca
agctttgatctttgggaagaaattaaggacgttcattactttactctagccgttcagaag
cgtgccatgcaagatggtacagcttttgcaaagagaattggagcacctgaccaagccgca
ctctaccaacgcacgatcgagcctattgatctaaaactgggagagttctgggatcctgga
atgggtgttattaagggttataaaggcagagtcgatcgctcaggacttgattgctccact
ttgcttgcaagcctttactcaaatgagtttgatatgcacatccttccaaccttgttgaag
ttgcaagaaaccatgaccagagattatcccgtcaatcagggatggaagcaagcaatggga
cgctatcccgaggatgtatacgatggtgtctctaagtctattggtaacccttggttcatt
tgcacaagcagcgctgccgagattatctacaaagcaatcgcatactacgataataaaggt
ttaccagaattgactgaatataacatccatttctttatgaaatttgctgagtttggagat
ccatacaactggtccgttatcaggaaaaacatgcacacatatgctgataactttttaaaa
gctgttgctgagttccaacatccaaatggttcaatgtctgaacaattttcgcgtgacgat
ggtcaccaaaaaggtgcaagagatttgacatggagttattcatccttattaaatgccatc
tacagaagagaggcaatcaaaggctctgtctaa

DBGET integrated database retrieval system