KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1539.09cHelp
Entry
SPBC1539.09c      CDS       T00076                                 

Gene name
trp1
Definition
anthranilate synthase component II (predicted) (EC:4.1.1.48 4.1.3.27)
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPBC1539.09c (trp1)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPBC1539.09c (trp1)
Enzymes [BR:spo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SPBC1539.09c (trp1)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SPBC1539.09c (trp1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SPBC1539.09c (trp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(4377221..4379500)
Genome map
AA seq 759 aa AA seqDB search
MSEKVDVGESVKGDASENAVKEVAERPIVMIDNYDSFTWNVVQYLSNLEKRYPIMVFRND
EITVDELEKLNPLKLVLSPGPGHPARDGGICNEAISRFAGKIPILGVCMGLQCIFETMGG
KVDSAGEIIHGKVSKINHDGLGFYQGIPQNISVTRYHSLAGKISSLPDCLDVTSWTENGV
IMGARHKKYAIEGVQYHPESILSEYGKEYIQNFLNLTAGTWEENGIVMPTKNNAFNAAMR
ENSNSVSSTKIRKQESILEKIHAQRLIDIAESKRKPGLSVGDLQTYLNLNIAPPCINFYE
RLKQSKPALMAEVKRASPSKGDIKLDANAAIQALTYAQVGASVISVLTEPKWFKGSLNDL
FVARKAVEHVANRPAILRKDFIIDPYQIMEARLNGADSVLLIVAMLSREQLESLYKFSKS
LGMEPLVEVNCAEEMKTAIELGAKVIGVNNRNLHSFEVDLSTTSKLAEMVPDDVILAALS
GISSPADVAHYSSQGVSAVLVGESLMRASDPAAFARELLNLSSSEISNGKKTSTPLVKVC
GTRSLLAAKTIVESGGDLIGLIFVEKSKRKVDLSVAKEISHFVHTTNRKHISPKKAVTGQ
SWFDHQYENLASSPHPLLVGVFQNQPLEYIRSIIAEVNLDIVQLHGQEPFEWIHMLDRPV
IKVFPLNSSEISRPNYHIVPLIDAYVGGESGGLGKKVDWEAASFIPVSYVLAGGLTPKNV
QDAISVSRPAVVDVSSGVETDGKQDLEKIKAFINAVKEL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaagttgacgttggtgaaagcgtcaaaggagacgcctcagaaaatgcagtt
aaagaagttgctgaaagaccaattgttatgatagataattatgacagtttcacctggaac
gttgttcaatatctttctaatctggaaaaacgatatcctattatggtttttcgcaatgat
gaaatcactgtcgatgaattagaaaaacttaatcctttaaaactagttctctcacctggg
cctggacatcctgcgcgtgatggtggtatttgtaacgaggctatttcgagatttgctgga
aagattcctatacttggtgtgtgtatgggacttcagtgtatttttgagacaatgggtggt
aaagttgattccgctggtgaaatcatacatggaaaagtttctaaaataaatcacgacggt
ctcggattttaccaaggaatacctcaaaatatttctgtaacaagatatcattctcttgct
ggaaaaatttcatcacttcctgattgtttggacgttacaagctggaccgagaatggtgta
ataatgggtgcacgccataaaaagtatgctattgagggtgttcaataccatcctgaaagt
atccttagtgagtatggcaaagagtatattcagaattttttgaatctcactgctggaacc
tgggaagaaaatggcattgttatgcctacaaaaaataacgcatttaacgcggctatgcgt
gaaaattcgaattctgtttcttcaactaaaattcgcaaacaagaatctatccttgagaaa
atccacgcgcagagacttattgacattgctgaaagtaaaagaaagcctggtctttctgtg
ggtgatttgcaaacatatttgaaccttaacatagcacctccatgtataaatttttatgag
agattaaagcaatctaaaccagctttaatggctgaagtcaaacgtgcttccccttctaaa
ggtgacattaagttagacgcaaatgctgctatccaagctcttacttatgctcaggttggc
gcctcagtcatatctgtgttaacagaaccaaaatggttcaaaggctcattgaatgatttg
tttgttgcgcgaaaagctgttgagcatgtagctaatcggcctgcaattttgagaaaggat
ttcattattgacccttatcaaattatggaggctcgtttgaatggtgctgatagtgtattg
ctaatcgttgcgatgttaagccgtgaacaattagagtccctctataaattttctaaatct
ttgggcatggaaccgttagtagaggttaactgtgctgaggaaatgaagactgctatagaa
cttggtgctaaagttatcggcgttaataacaggaatttgcatagttttgaagtagacctt
tccactacatcaaaattagccgaaatggtcccagatgatgttattcttgcagctctcagt
ggaattagtagtcctgctgatgttgcccattatagtagtcaaggtgtatcagcagttctt
gttggtgaatctcttatgagagcttcggatcctgccgcttttgcacgagagttacttaat
ctttcttctagcgagatatctaatggtaaaaaaacatcaacacccctagtgaaggtatgt
ggtactcgttcattgttagctgctaaaaccattgtagaatcaggaggcgatttgataggg
ttaatttttgtggaaaagagcaaacgaaaagtggacttgtccgtggccaaggaaatttca
cattttgttcatacaaccaatagaaaacacatttccccaaagaaagcagtgactggtcaa
agttggtttgatcatcagtatgaaaatcttgcttcctctccgcaccctttgttagtcggt
gtgttccaaaatcaaccattagaatacattcgttctataatagcagaagtgaacttggat
attgtccagcttcatggacaagaacctttcgaatggatacatatgctcgatagacctgtt
attaaggtgtttccgctaaattcttctgaaatttcaaggcccaactatcatattgtacct
ttgattgatgcatatgtcggtggagagtcaggaggtttaggcaagaaagtagactgggaa
gctgcatctttcattccagtatcttatgtcttagctggtggtctaacacctaaaaatgta
caagatgctatatctgttagccgcccagctgtagtcgatgtatcgagtggggtggagact
gacgggaaacaagatcttgaaaagatcaaggcatttataaacgccgtaaaagaactttaa

DBGET integrated database retrieval system