KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1604.21cHelp
Entry
SPBC1604.21c      CDS       T00076                                 

Gene name
ptr3, SPBC211.09, uba1
Definition
ubiquitin activating enzyme E1
Orthology
K03178  
ubiquitin-activating enzyme E1 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC1604.21c (ptr3)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPBC1604.21c (ptr3)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPBC1604.21c (ptr3)
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC1604.21c (ptr3)
  Exosomal proteins of colorectal cancer cells
   SPBC1604.21c (ptr3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:join(3888696..3888701,3888760..3888824,3888933..3891900)
Genome map
AA seq 1012 aa AA seqDB search
MSNNMNIDQTDQNTIDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAG
VKSVTLYDPQPTRIEDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVSVVDELSTEYL
KNFKCVVVTETSLTKQLEINDFTHKNHIAYIAADSRGLFGSIFCDFGENFICTDTDGNEP
LTGMIASITDDGVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSIG
SVKDLGSAGYNGVFTQVKVPTKISFKSLRESLKDPEYVYPDFGKMMRPPQYHIAFQALSA
FADAHEGSLPRPRNDIDAAEFFEFCKKIASTLQFDVELDEKLIKEISYQARGDLVAMSAF
LGGAVAQEVLKATTSKFYPLKQYFYFDSLESLPSSVTISEETCKPRGCRYDGQIAVFGSE
FQEKIASLSTFLVGAGAIGCEMLKNWAMMGVATGESGHISVTDMDSIEKSNLNRQFLFRP
RDVGKLKSECASTAVSIMNPSLTGKITSYQERVGPESEGIFGDEFFEKLSLVTNALDNVE
ARMYVDRRCVFFEKPLLESGTLGTKGNTQVVVPHLTESYGSSQDPPEKSFPICTLKNFPN
RIEHTIAWARDLFEGLFKQPIDNVNMYLSSPNFLETSLKTSSNPREVLENIRDYLVTEKP
LSFEECIMWARLQFDKFFNNNIQQLLFNFPKDSVTSTGQPFWSGPKRAPTPLSFDIHNRE
HFDFIVAAASLYAFNYGLKSETDPAIYERVLAGYNPPPFAPKSGIKIQVNENEEAPETAA
NKDKQELKSIADSLPPPSSLVGFRLTPAEFEKDDDSNHHIDFITAASNLRAMNYDITPAD
RFKTKFVAGKIVPAMCTSTAVVSGLVCLELVKLVDGKKKIEEYKNGFFNLAIGLFTFSDP
IASPKMKVNGKEIDKIWDRYNLPDCTLQELIDYFQKEEGLEVTMLSSGVSLLYANFQPPK
KLAERLPLKISELVEQITKKKLEPFRKHLVLEICCDDANGEDVEVPFICIKL
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataacatgaacattgatcaaacggatcaaaatactatcgatgaagggctttac
tctagacaactttatgttttaggccatgaggctatgaaacaaatgagtcagtcgaatgtc
ttaatcattggctgcaaaggtttaggcgttgaaatagcaaagaacgtttgtctagcaggt
gtaaaaagcgttactctttacgatcctcaacctacacgcattgaggacttatcatcacaa
tattttcttacagaagacgatattggtgttcctcgtgcaaaagtaacggtatcaaagtta
gcagagcttaatcaatatgtgcctgtttctgtagttgatgaactttcaacagagtatcta
aaaaacttcaaatgcgtggttgtcacagaaacttctcttacgaaacagctagaaattaac
gactttacacacaaaaaccatattgcttatattgctgctgacagccgtggtctttttgga
tcgatattttgtgattttggtgagaactttatttgtactgacactgatggaaatgaacct
ttaactggaatgatcgcttcaattactgatgatggagttgttaccatgcttgaagaaact
cgtcatggattggagaatggtgattttgttaaatttaccgaagtgaagggtatgcctggt
ttaaatgatggcactcctcgtaaagttgaagtgaaaggtccatataccttttctatcgga
tctgttaaagatttaggaagtgccggttacaatggtgtctttacccaagttaaagttcca
accaaaatatctttcaaatctctccgcgaatcgctcaaggaccctgaatatgtatatcct
gactttggtaaaatgatgagacctccacaataccacattgctttccaggccctttcagca
tttgccgatgcgcatgaaggttcattgcctcgaccccgtaacgacattgatgcagctgaa
tttttcgaattttgtaagaaaattgcaagcacacttcaatttgatgttgaactcgatgaa
aaactaattaaggaaatttcataccaggcaagaggtgatttggttgcaatgtccgcgttt
ttgggcggtgctgtagcacaggaagtgttgaaagctaccaccagtaaattttacccattg
aagcaatacttctattttgactccttagaaagcttgccatcttctgtaacgatcagtgaa
gaaacttgtaaacctcgtggctgtcgatacgatgggcaaatcgctgttttcggttcggaa
tttcaagagaaaatagcttctttgagtacgtttttggttggtgctggcgctattggatgt
gaaatgctgaaaaactgggctatgatgggtgtcgctactggtgaaagtggtcatatttct
gttactgatatggactccattgaaaaatcgaatttgaatcgtcaatttctctttcgtcct
cgtgacgtcggaaagctgaagtccgaatgtgcttctaccgctgtttcaatcatgaatcct
tcattgactggtaaaataacttcatatcaagaacgtgttggaccagaaagcgaaggcata
tttggcgatgaattctttgaaaagttatctttagtcacgaatgctttggataacgtcgaa
gctcgaatgtatgttgaccgccgttgtgtatttttcgaaaagccattattagagtctggt
actttgggtactaagggtaatacgcaagttgttgtacctcatcttacagagtcgtacgga
tcatcccaagaccctcctgaaaagtcatttcctatctgtactttgaagaactttcctaac
cgtattgagcacaccattgcatgggctcgcgatctctttgaaggcttgtttaaacagcct
atcgataacgttaatatgtaccttagttctcctaactttttggaaacttcattgaaaacg
agtagtaacccccgtgaagttttagaaaatattagagattatcttgttacggagaagcct
ctttcatttgaggaatgtattatgtgggcccgtttgcagtttgataagttctttaacaac
aacattcagcaattacttttcaatttccctaaggattctgtaacctccactggccaaccg
ttttggtctggtcctaagcgtgcccctactccattatcttttgatattcacaaccgtgag
cattttgacttcatagttgcagcagccagtctttatgcattcaactacggccttaagagt
gagacagacccagctatttacgaacgcgttcttgctggctacaatcctcctccctttgct
cccaagtctggtattaaaattcaagtcaatgaaaatgaagaagctcccgaaaccgctgct
aataaagataaacaagaactgaaatcgattgctgacagtctaccacctccatcctctctt
gtgggttttagactaactccggcagaatttgaaaaggacgatgactctaatcatcacatt
gactttataacggctgcatcaaatttgcgtgccatgaattacgacatcacacctgcggat
aggtttaagacgaagtttgttgccggtaaaattgtaccagccatgtgtacatcaactgct
gtcgtttcaggacttgtatgtcttgagcttgttaaacttgttgatggcaaaaagaagatc
gaggaatataaaaatggatttttcaaccttgctatagggctctttacattttctgatcct
attgcttctccgaaaatgaaagtcaatggtaaagaaatcgacaaaatctgggatcgctac
aatctcccggactgcacacttcaagagcttattgattatttccaaaaagaagaggggttg
gaagtgaccatgctttcatctggagtttctcttttgtatgctaatttccaaccacctaag
aaacttgctgaaaggttgcctctcaaaatttctgaattggttgagcaaattactaagaaa
aaactagaacctttccggaaacacttggtgcttgaaatttgctgtgatgatgccaacggt
gaagacgttgaagttccatttatttgtatcaagttgtaa

DBGET integrated database retrieval system