KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1604.21cHelp
Entry
SPBC1604.21c      CDS       T00076                                 

Gene name
ptr3, SPBC211.09, uba1
Definition
ubiquitin activating enzyme E1
Orthology
K03178  
ubiquitin-activating enzyme E1 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:join(3888696..3888701,3888760..3888824,3888933..3891900)
Genome map
AA seq 1012 aa AA seqDB search
MSNNMNIDQTDQNTIDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAG
VKSVTLYDPQPTRIEDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVSVVDELSTEYL
KNFKCVVVTETSLTKQLEINDFTHKNHIAYIAADSRGLFGSIFCDFGENFICTDTDGNEP
LTGMIASITDDGVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSIG
SVKDLGSAGYNGVFTQVKVPTKISFKSLRESLKDPEYVYPDFGKMMRPPQYHIAFQALSA
FADAHEGSLPRPRNDIDAAEFFEFCKKIASTLQFDVELDEKLIKEISYQARGDLVAMSAF
LGGAVAQEVLKATTSKFYPLKQYFYFDSLESLPSSVTISEETCKPRGCRYDGQIAVFGSE
FQEKIASLSTFLVGAGAIGCEMLKNWAMMGVATGESGHISVTDMDSIEKSNLNRQFLFRP
RDVGKLKSECASTAVSIMNPSLTGKITSYQERVGPESEGIFGDEFFEKLSLVTNALDNVE
ARMYVDRRCVFFEKPLLESGTLGTKGNTQVVVPHLTESYGSSQDPPEKSFPICTLKNFPN
RIEHTIAWARDLFEGLFKQPIDNVNMYLSSPNFLETSLKTSSNPREVLENIRDYLVTEKP
LSFEECIMWARLQFDKFFNNNIQQLLFNFPKDSVTSTGQPFWSGPKRAPTPLSFDIHNRE
HFDFIVAAASLYAFNYGLKSETDPAIYERVLAGYNPPPFAPKSGIKIQVNENEEAPETAA
NKDKQELKSIADSLPPPSSLVGFRLTPAEFEKDDDSNHHIDFITAASNLRAMNYDITPAD
RFKTKFVAGKIVPAMCTSTAVVSGLVCLELVKLVDGKKKIEEYKNGFFNLAIGLFTFSDP
IASPKMKVNGKEIDKIWDRYNLPDCTLQELIDYFQKEEGLEVTMLSSGVSLLYANFQPPK
KLAERLPLKISELVEQITKKKLEPFRKHLVLEICCDDANGEDVEVPFICIKL
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataacatgaacattgatcaaacggatcaaaatactatcgatgaagggctttac
tctagacaactttatgttttaggccatgaggctatgaaacaaatgagtcagtcgaatgtc
ttaatcattggctgcaaaggtttaggcgttgaaatagcaaagaacgtttgtctagcaggt
gtaaaaagcgttactctttacgatcctcaacctacacgcattgaggacttatcatcacaa
tattttcttacagaagacgatattggtgttcctcgtgcaaaagtaacggtatcaaagtta
gcagagcttaatcaatatgtgcctgtttctgtagttgatgaactttcaacagagtatcta
aaaaacttcaaatgcgtggttgtcacagaaacttctcttacgaaacagctagaaattaac
gactttacacacaaaaaccatattgcttatattgctgctgacagccgtggtctttttgga
tcgatattttgtgattttggtgagaactttatttgtactgacactgatggaaatgaacct
ttaactggaatgatcgcttcaattactgatgatggagttgttaccatgcttgaagaaact
cgtcatggattggagaatggtgattttgttaaatttaccgaagtgaagggtatgcctggt
ttaaatgatggcactcctcgtaaagttgaagtgaaaggtccatataccttttctatcgga
tctgttaaagatttaggaagtgccggttacaatggtgtctttacccaagttaaagttcca
accaaaatatctttcaaatctctccgcgaatcgctcaaggaccctgaatatgtatatcct
gactttggtaaaatgatgagacctccacaataccacattgctttccaggccctttcagca
tttgccgatgcgcatgaaggttcattgcctcgaccccgtaacgacattgatgcagctgaa
tttttcgaattttgtaagaaaattgcaagcacacttcaatttgatgttgaactcgatgaa
aaactaattaaggaaatttcataccaggcaagaggtgatttggttgcaatgtccgcgttt
ttgggcggtgctgtagcacaggaagtgttgaaagctaccaccagtaaattttacccattg
aagcaatacttctattttgactccttagaaagcttgccatcttctgtaacgatcagtgaa
gaaacttgtaaacctcgtggctgtcgatacgatgggcaaatcgctgttttcggttcggaa
tttcaagagaaaatagcttctttgagtacgtttttggttggtgctggcgctattggatgt
gaaatgctgaaaaactgggctatgatgggtgtcgctactggtgaaagtggtcatatttct
gttactgatatggactccattgaaaaatcgaatttgaatcgtcaatttctctttcgtcct
cgtgacgtcggaaagctgaagtccgaatgtgcttctaccgctgtttcaatcatgaatcct
tcattgactggtaaaataacttcatatcaagaacgtgttggaccagaaagcgaaggcata
tttggcgatgaattctttgaaaagttatctttagtcacgaatgctttggataacgtcgaa
gctcgaatgtatgttgaccgccgttgtgtatttttcgaaaagccattattagagtctggt
actttgggtactaagggtaatacgcaagttgttgtacctcatcttacagagtcgtacgga
tcatcccaagaccctcctgaaaagtcatttcctatctgtactttgaagaactttcctaac
cgtattgagcacaccattgcatgggctcgcgatctctttgaaggcttgtttaaacagcct
atcgataacgttaatatgtaccttagttctcctaactttttggaaacttcattgaaaacg
agtagtaacccccgtgaagttttagaaaatattagagattatcttgttacggagaagcct
ctttcatttgaggaatgtattatgtgggcccgtttgcagtttgataagttctttaacaac
aacattcagcaattacttttcaatttccctaaggattctgtaacctccactggccaaccg
ttttggtctggtcctaagcgtgcccctactccattatcttttgatattcacaaccgtgag
cattttgacttcatagttgcagcagccagtctttatgcattcaactacggccttaagagt
gagacagacccagctatttacgaacgcgttcttgctggctacaatcctcctccctttgct
cccaagtctggtattaaaattcaagtcaatgaaaatgaagaagctcccgaaaccgctgct
aataaagataaacaagaactgaaatcgattgctgacagtctaccacctccatcctctctt
gtgggttttagactaactccggcagaatttgaaaaggacgatgactctaatcatcacatt
gactttataacggctgcatcaaatttgcgtgccatgaattacgacatcacacctgcggat
aggtttaagacgaagtttgttgccggtaaaattgtaccagccatgtgtacatcaactgct
gtcgtttcaggacttgtatgtcttgagcttgttaaacttgttgatggcaaaaagaagatc
gaggaatataaaaatggatttttcaaccttgctatagggctctttacattttctgatcct
attgcttctccgaaaatgaaagtcaatggtaaagaaatcgacaaaatctgggatcgctac
aatctcccggactgcacacttcaagagcttattgattatttccaaaaagaagaggggttg
gaagtgaccatgctttcatctggagtttctcttttgtatgctaatttccaaccacctaag
aaacttgctgaaaggttgcctctcaaaatttctgaattggttgagcaaattactaagaaa
aaactagaacctttccggaaacacttggtgcttgaaatttgctgtgatgatgccaacggt
gaagacgttgaagttccatttatttgtatcaagttgtaa

DBGET integrated database retrieval system