KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1683.11cHelp
Entry
SPBC1683.11c      CDS       T00076                                 

Definition
isocitrate lyase (predicted) (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPBC1683.11c
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SPBC1683.11c
Enzymes [BR:spo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SPBC1683.11c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(166792..168348)
Genome map
AA seq 518 aa AA seqDB search
MTTDMDLEQLEYEKEVEEIEKWWATPKQSQIKRPYTASTVAVLSEVTKAYYPSSQQALKL
YDLLREHRNKGTATLTYGVVDPVLASQASKAGLETIFVSGCLCGLSSVDEPGMDHADYPW
DTVPKAVDRIFRSQNWHARRQKQFHLMKPAEERKQLPKYDYLLPIIADGDMGFGSVTSTM
KMTKRFVESGVAMIHLDDLAIGLKRFTVGQGRTVVPTSEYLRRLTAVRLQFDIMKAETML
LCRCDTDHAEFITSVVDPRDHAYVLGATTKIESLIKALKDAESTGVSMKKARENWIERAK
LMTFDEAVKSTATPKEYENYISAISKKPFHSISERQELAEKYLSNEVFFDWELPRSSDGQ
YFFKPTVQTVIERAIAAAPLGEMTWARMDYPKWQDIKAFHEGVRAVYPDRMFAFGFTGNY
DFKAAGFSEEQLRNLTSDMAKLGVCWQVQPYFTCQVLNKASVDYSNIWKKDGIFGYVKTV
QEPALKEDVDGFENEWCGTYFADKLLSAAGSSDKTIPY
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagacatggatttagagcaacttgagtacgagaaagaagtagaggagattgag
aaatggtgggcaaccccaaagcaatcccaaattaagagaccgtacactgcatcaacagta
gcagtattgagtgaagtgactaaagcatattacccttcttcacaacaggcattaaagctg
tatgatttgctacgtgagcatcgaaataaaggtacagctaccttgacatacggcgttgtt
gacccggtacttgcttctcaggcatcaaaagcaggattagaaacaattttcgtttctggg
tgtctttgtggactatctagtgtggatgagcctggcatggatcatgccgattatccatgg
gacaccgtacctaaagctgttgacaggatctttcgaagccaaaactggcatgcaagacgg
caaaagcaatttcaccttatgaagcctgcagaggagagaaagcagttgccaaaatatgat
tatctattacccattatcgctgatggagatatgggatttggcagtgtaacatccactatg
aaaatgacaaagagatttgtagagagtggtgttgctatgattcacttagatgatttggct
ataggtcttaaacgcttcacggtgggtcagggaagaactgtagtccctacttcagaatat
cttcgtcgacttactgcggtcagacttcaatttgatattatgaaagcagaaactatgcta
ttgtgtcgttgtgatactgaccacgctgagttcattacttcagtcgtagatccccgcgac
catgcctatgtcttgggagcgaccactaagatagaatcattaattaaagcactaaaggat
gcagaaagtaccggtgtaagcatgaagaaagcaagggagaactggattgagcgagcgaaa
ttgatgacttttgatgaagccgttaagtccacagctacccctaaagaatatgagaattat
atatctgccatttcgaagaaaccattccatagcatttcagaaagacaagaattggcagaa
aagtacctttccaatgaggtattctttgactgggagctcccaagaagctcagacggtcag
tattttttcaagccaactgtccaaacggttattgaacgagcaattgctgcagcaccatta
ggagaaatgacttgggcaagaatggactatccaaaatggcaggacattaaagcttttcat
gaaggtgtgcgtgctgtatatccggaccgtatgtttgcttttggttttacaggcaattac
gattttaaggccgctggcttttctgaagaacaacttcgtaatcttactagcgacatggcg
aaattaggagtttgctggcaagtccagccctactttacttgccaggtattaaataaagca
tcagttgattacagtaatatttggaagaaagatggaatttttggttacgttaaaacagtt
caggaaccagcacttaaagaagatgtggatggttttgagaacgaatggtgcggaacttac
tttgccgataaactgttgagcgcagctggctccagcgacaagacaattccatactag

DBGET integrated database retrieval system