KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16A3.05cHelp
Entry
SPBC16A3.05c      CDS       T00076                                 

Gene name
rae1, cut21
Definition
(RefSeq) RNA export factor, nucleoporin Rae1
  KO
K14298  mRNA export factor
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPBC16A3.05c (rae1)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     SPBC16A3.05c (rae1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    SPBC16A3.05c (rae1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 Nup160 WD40_like eIF2A
Motif
Other DBs
NCBI-GeneID: 2539741
NCBI-ProteinID: NP_596784
PomBase: SPBC16A3.05c
UniProt: P41838
Position
II:join(4288945..4289016,4289067..4289143,4289563..4290472)
Genome map
AA seq 352 aa AA seqDB search
MSLFGQATTSTVSNATGDLKKDVEVAQPPEDSISDLAFSPQAEYLAASSWDSKVRIYEVQ
ATGQSIGKALYEHQGPVLSVNWSRDGTKVASGSVDKSAKVFDIQTGQNQQVAAHDDAVRC
VRFVEAMGTSPILATGSWDKTLKYWDLRQSTPIATVSLPERVYAMDCVHPLLTVATAERN
ICVINLSEPTKIFKLAMSPLKFQTRSLACFIKGDGYAIGSVEGRCAIQNIDEKNASQNFS
FRCHRNQAGNSADVYSVNSIAFHPQYGTFSTAGSDGTFSFWDKDSHQRLKSYPNVGGTIS
CSTFNRTGDIFAYAISYDWSKGYTFNNAQLPNKIMLHPVPQDEIKPRPKKGR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcactttttggacaggctacaacatctacagtatctaatgcaaccggtgacttaaaa
aaggatgtggaggttgcccaacccccggaggattcaatatcagatttggctttttctcct
caagcagaatatttagctgcatcatcttgggatagtaaagtccgtatttacgaagtgcaa
gctacagggcaatcaattggaaaagcactttatgaacaccaaggtccggtattaagtgtc
aattggtctcgagatggtaccaaagtagcatcaggaagtgtggataagtctgctaaagtc
tttgatattcaaacggggcaaaatcagcaggttgcggctcatgacgatgctgttcgttgc
gttcgtttcgttgaagctatgggtacttcacctattctggcaactgggtcatgggacaaa
accttgaaatattgggatcttcgacaatcaacacccattgctacagtcagtcttccagaa
cgtgtttatgcgatggattgtgttcatccattacttaccgttgcaaccgctgaaaggaac
atatgtgttatcaacttgtcggaaccaacgaaaatatttaaactggctatgagtccattg
aagttccagacaagatctttggcttgttttattaaaggtgatggttatgctataggaagc
gttgaaggaagatgtgcgatccaaaatatagatgaaaaaaatgcatctcaaaacttcagt
tttcgctgtcataggaatcaagcaggtaacagtgctgatgtttacagtgtaaattctata
gcatttcatccccaatatggaactttctcaaccgccggatctgatggtacttttagtttt
tgggataaagatagtcatcagcgtttaaagagttatccaaatgttggtgggactatttct
tgcagcacgtttaatcgtactggagatatttttgcttatgccattagttacgactggagt
aaaggttatacattcaacaatgcgcaattgcccaataaaatcatgctccaccctgttccg
caagacgaaataaaacctcgacctaagaaaggaaggtaa

DBGET integrated database retrieval system