KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16A3.05cHelp
Entry
SPBC16A3.05c      CDS       T00076                                 

Gene name
rae1, cut21
Definition
RNA export factor, nucleoporin Rae1
Orthology
K14298  
mRNA export factor
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPBC16A3.05c (rae1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(4288945..4289016,4289067..4289143,4289563..4290472)
Genome map
AA seq 352 aa AA seqDB search
MSLFGQATTSTVSNATGDLKKDVEVAQPPEDSISDLAFSPQAEYLAASSWDSKVRIYEVQ
ATGQSIGKALYEHQGPVLSVNWSRDGTKVASGSVDKSAKVFDIQTGQNQQVAAHDDAVRC
VRFVEAMGTSPILATGSWDKTLKYWDLRQSTPIATVSLPERVYAMDCVHPLLTVATAERN
ICVINLSEPTKIFKLAMSPLKFQTRSLACFIKGDGYAIGSVEGRCAIQNIDEKNASQNFS
FRCHRNQAGNSADVYSVNSIAFHPQYGTFSTAGSDGTFSFWDKDSHQRLKSYPNVGGTIS
CSTFNRTGDIFAYAISYDWSKGYTFNNAQLPNKIMLHPVPQDEIKPRPKKGR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcactttttggacaggctacaacatctacagtatctaatgcaaccggtgacttaaaa
aaggatgtggaggttgcccaacccccggaggattcaatatcagatttggctttttctcct
caagcagaatatttagctgcatcatcttgggatagtaaagtccgtatttacgaagtgcaa
gctacagggcaatcaattggaaaagcactttatgaacaccaaggtccggtattaagtgtc
aattggtctcgagatggtaccaaagtagcatcaggaagtgtggataagtctgctaaagtc
tttgatattcaaacggggcaaaatcagcaggttgcggctcatgacgatgctgttcgttgc
gttcgtttcgttgaagctatgggtacttcacctattctggcaactgggtcatgggacaaa
accttgaaatattgggatcttcgacaatcaacacccattgctacagtcagtcttccagaa
cgtgtttatgcgatggattgtgttcatccattacttaccgttgcaaccgctgaaaggaac
atatgtgttatcaacttgtcggaaccaacgaaaatatttaaactggctatgagtccattg
aagttccagacaagatctttggcttgttttattaaaggtgatggttatgctataggaagc
gttgaaggaagatgtgcgatccaaaatatagatgaaaaaaatgcatctcaaaacttcagt
tttcgctgtcataggaatcaagcaggtaacagtgctgatgtttacagtgtaaattctata
gcatttcatccccaatatggaactttctcaaccgccggatctgatggtacttttagtttt
tgggataaagatagtcatcagcgtttaaagagttatccaaatgttggtgggactatttct
tgcagcacgtttaatcgtactggagatatttttgcttatgccattagttacgactggagt
aaaggttatacattcaacaatgcgcaattgcccaataaaatcatgctccaccctgttccg
caagacgaaataaaacctcgacctaagaaaggaaggtaa

DBGET integrated database retrieval system