KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16C6.09Help
Entry
SPBC16C6.09       CDS       T00076                                 

Gene name
ogm4, oma4
Definition
protein O-mannosyltransferase Ogm4 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:spo00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:4346652..4348988
Genome map
AA seq 778 aa AA seqDB search
MASKSEKAVKKAQKLSKEPSVELTDTKSSDNVTPKQKSPNSTEEDVSLNLKTLKAKKFKL
AFVLITVLSFITRFWNLNLPGEVVFDEVHFGKFASYYLQGKYFFDLHPPFAKLLLALVAK
LAGYDGHYLFDNIGDNYKDNGVPYVTIRAWPALLSSLVPPVVFLIMKESGYDLLACIVSS
SLVLFDNAHVTEGRLILLDATLLFSMVCAIYCYVRFFKLRHTPFSRPWWAWLFFTGFFLS
CTISTKYVGFFTFLSIGLSVCLELWYLWDIKTGLTVERFFQHFLARFFCLIFFPFLFFLF
WFYMHFNILTISGPGDSFMSLEFQETLSDNPITANSTILNYYDIVTIKHMGTNAFLHSHP
EKYPIPYDDGRISSGGQQVTGYQFDDENNYWMILPADHYDPPIEAKLNVPVKNMDYIKLH
HVGTNTDLMTHDVASPYHPTNEEFTTVSVDESAGKKHEYTLFQVVMSDNTDPQRPLYTKA
SSFKLIHKLTHVAMWSDPKPLPDWAFKQLEINGAKNIQTGSIFWTFDDIIGLKDSRLKKE
KKIPKKLPFWKKYLELQLTMFRQNNMLTEFHPYSSNPSDWFTLHHGIAFWAKSEENKQIY
LLGNPIGWWIIAGTVLSTTVVAAAEILLRQRGIRTLPETVRNHFYRSTMFFYMTYVFHYL
PFFIMGRQLFLHHYLPAHLAGSLLVGAFIQLACRKSFRSPVSAGVPIPKDVDEKGHSKCH
RKYGHVIELICTLLLIFVVIYCFTFFAPMTYGDKSLSVDEWTRRKWLDSWVFQYQKQN
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaatctgaaaaagctgtaaagaaagcccaaaaattgagcaaagagccatct
gttgaattaactgacacgaagtcttctgataatgttactccaaaacagaaatctccaaat
tctacagaagaagatgtaagtttgaatctcaagacgttgaaagccaaaaaatttaagctt
gcttttgttttgataacggtactttcatttataactcgcttttggaacttgaatcttcct
ggtgaagttgtcttcgacgaagtacattttggtaaatttgcaagctactatttgcaaggg
aaatatttttttgatctccatccacccttcgcaaagttgcttttggctctcgtagctaag
cttgcgggttatgatggccattatttgtttgataatataggcgataactataaagataac
ggcgtcccttatgttacgattcgagcttggcctgcactccttagttccctggttccaccc
gtagtttttctaatcatgaaagagtcaggatacgatttgttagcgtgtatcgtttcatca
tccttggtcctcttcgataatgctcacgttactgaaggaagattaattttacttgatgca
actttacttttctctatggtatgtgccatatactgttacgttcgtttttttaagctacgc
catacccccttttctcgaccatggtgggcctggcttttttttactggattcttcttatct
tgtacaattagtactaagtatgttggtttttttacatttttatccataggactgagtgtc
tgcttagaactatggtatctttgggatattaaaaccggtcttactgttgagcgttttttc
cagcactttttggctcgtttcttttgtcttatctttttcccttttctattctttttattt
tggttttacatgcactttaacattctcacgatcagcgggcctggtgactcctttatgtct
cttgaatttcaagaaacactgagtgacaacccaattactgccaattctacgattttgaat
tattatgatattgtcactattaaacacatgggaacgaacgcatttcttcattctcatcct
gaaaaataccctattccttatgacgatggtcgtatttcttctggtggacaacaagtaacc
ggatatcaatttgacgatgaaaacaattactggatgatccttcctgctgatcactacgat
ccccccattgaagccaaacttaatgtacccgtgaaaaatatggactatattaaactccat
cacgttggtactaatactgatttgatgactcatgacgttgcttccccataccatcctact
aatgaagaatttactacagttagtgtagatgaatctgctgggaaaaaacatgagtacacg
ttgtttcaagtggttatgagtgataatactgatcctcagcgacctttatataccaaagct
tcttctttcaaattgatccataaactcactcatgtggctatgtggtctgatccaaagcca
cttccagattgggcatttaaacagctagaaatcaatggtgctaaaaacattcaaactggg
tcaattttctggacattcgatgatattatcggacttaaagatagccgattgaagaaggaa
aaaaaaattcctaaaaaactaccattttggaaaaaatatttggagctacaactcacaatg
tttagacaaaataatatgttaaccgagtttcatccatacagttctaatccttctgattgg
tttactttgcaccacggtattgcgttttgggctaaaagtgaggaaaacaagcaaatatat
ttattgggaaatcctatcggttggtggatcattgccggtactgttttgagtacgacggtg
gtcgctgcagctgaaattttgcttcgccaaagaggtattcgtactttacctgaaactgtc
cgtaaccacttttaccgttccactatgtttttctacatgacttatgtctttcattatctt
ccattctttatcatgggtcgtcaattgtttttacaccattatcttcctgctcatttggca
ggttccttgcttgtaggcgcatttatacagttagcctgtcgcaaatccttccgatcaccc
gtgtccgcaggagttccgattcctaaagatgtcgatgaaaaaggacattccaaatgtcat
agaaaatacggtcatgtaatagagctcatctgtacattactactcatttttgtcgttatt
tattgtttcacctttttcgctccaatgacatacggagataaaagccttagcgttgatgaa
tggacgagacgtaaatggcttgattcatgggtgtttcaataccaaaaacaaaattag

DBGET integrated database retrieval system