KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16C6.09Help
Entry
SPBC16C6.09       CDS       T00076                                 

Gene name
ogm4, oma4
Definition
protein O-mannosyltransferase Ogm4 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    SPBC16C6.09 (ogm4)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     SPBC16C6.09 (ogm4)
Glycosyltransferases [BR:spo01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   SPBC16C6.09 (ogm4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:4346652..4348988
Genome map
AA seq 778 aa AA seqDB search
MASKSEKAVKKAQKLSKEPSVELTDTKSSDNVTPKQKSPNSTEEDVSLNLKTLKAKKFKL
AFVLITVLSFITRFWNLNLPGEVVFDEVHFGKFASYYLQGKYFFDLHPPFAKLLLALVAK
LAGYDGHYLFDNIGDNYKDNGVPYVTIRAWPALLSSLVPPVVFLIMKESGYDLLACIVSS
SLVLFDNAHVTEGRLILLDATLLFSMVCAIYCYVRFFKLRHTPFSRPWWAWLFFTGFFLS
CTISTKYVGFFTFLSIGLSVCLELWYLWDIKTGLTVERFFQHFLARFFCLIFFPFLFFLF
WFYMHFNILTISGPGDSFMSLEFQETLSDNPITANSTILNYYDIVTIKHMGTNAFLHSHP
EKYPIPYDDGRISSGGQQVTGYQFDDENNYWMILPADHYDPPIEAKLNVPVKNMDYIKLH
HVGTNTDLMTHDVASPYHPTNEEFTTVSVDESAGKKHEYTLFQVVMSDNTDPQRPLYTKA
SSFKLIHKLTHVAMWSDPKPLPDWAFKQLEINGAKNIQTGSIFWTFDDIIGLKDSRLKKE
KKIPKKLPFWKKYLELQLTMFRQNNMLTEFHPYSSNPSDWFTLHHGIAFWAKSEENKQIY
LLGNPIGWWIIAGTVLSTTVVAAAEILLRQRGIRTLPETVRNHFYRSTMFFYMTYVFHYL
PFFIMGRQLFLHHYLPAHLAGSLLVGAFIQLACRKSFRSPVSAGVPIPKDVDEKGHSKCH
RKYGHVIELICTLLLIFVVIYCFTFFAPMTYGDKSLSVDEWTRRKWLDSWVFQYQKQN
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaatctgaaaaagctgtaaagaaagcccaaaaattgagcaaagagccatct
gttgaattaactgacacgaagtcttctgataatgttactccaaaacagaaatctccaaat
tctacagaagaagatgtaagtttgaatctcaagacgttgaaagccaaaaaatttaagctt
gcttttgttttgataacggtactttcatttataactcgcttttggaacttgaatcttcct
ggtgaagttgtcttcgacgaagtacattttggtaaatttgcaagctactatttgcaaggg
aaatatttttttgatctccatccacccttcgcaaagttgcttttggctctcgtagctaag
cttgcgggttatgatggccattatttgtttgataatataggcgataactataaagataac
ggcgtcccttatgttacgattcgagcttggcctgcactccttagttccctggttccaccc
gtagtttttctaatcatgaaagagtcaggatacgatttgttagcgtgtatcgtttcatca
tccttggtcctcttcgataatgctcacgttactgaaggaagattaattttacttgatgca
actttacttttctctatggtatgtgccatatactgttacgttcgtttttttaagctacgc
catacccccttttctcgaccatggtgggcctggcttttttttactggattcttcttatct
tgtacaattagtactaagtatgttggtttttttacatttttatccataggactgagtgtc
tgcttagaactatggtatctttgggatattaaaaccggtcttactgttgagcgttttttc
cagcactttttggctcgtttcttttgtcttatctttttcccttttctattctttttattt
tggttttacatgcactttaacattctcacgatcagcgggcctggtgactcctttatgtct
cttgaatttcaagaaacactgagtgacaacccaattactgccaattctacgattttgaat
tattatgatattgtcactattaaacacatgggaacgaacgcatttcttcattctcatcct
gaaaaataccctattccttatgacgatggtcgtatttcttctggtggacaacaagtaacc
ggatatcaatttgacgatgaaaacaattactggatgatccttcctgctgatcactacgat
ccccccattgaagccaaacttaatgtacccgtgaaaaatatggactatattaaactccat
cacgttggtactaatactgatttgatgactcatgacgttgcttccccataccatcctact
aatgaagaatttactacagttagtgtagatgaatctgctgggaaaaaacatgagtacacg
ttgtttcaagtggttatgagtgataatactgatcctcagcgacctttatataccaaagct
tcttctttcaaattgatccataaactcactcatgtggctatgtggtctgatccaaagcca
cttccagattgggcatttaaacagctagaaatcaatggtgctaaaaacattcaaactggg
tcaattttctggacattcgatgatattatcggacttaaagatagccgattgaagaaggaa
aaaaaaattcctaaaaaactaccattttggaaaaaatatttggagctacaactcacaatg
tttagacaaaataatatgttaaccgagtttcatccatacagttctaatccttctgattgg
tttactttgcaccacggtattgcgttttgggctaaaagtgaggaaaacaagcaaatatat
ttattgggaaatcctatcggttggtggatcattgccggtactgttttgagtacgacggtg
gtcgctgcagctgaaattttgcttcgccaaagaggtattcgtactttacctgaaactgtc
cgtaaccacttttaccgttccactatgtttttctacatgacttatgtctttcattatctt
ccattctttatcatgggtcgtcaattgtttttacaccattatcttcctgctcatttggca
ggttccttgcttgtaggcgcatttatacagttagcctgtcgcaaatccttccgatcaccc
gtgtccgcaggagttccgattcctaaagatgtcgatgaaaaaggacattccaaatgtcat
agaaaatacggtcatgtaatagagctcatctgtacattactactcatttttgtcgttatt
tattgtttcacctttttcgctccaatgacatacggagataaaagccttagcgttgatgaa
tggacgagacgtaaatggcttgattcatgggtgtttcaataccaaaaacaaaattag

DBGET integrated database retrieval system