KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16E9.11cHelp
Entry
SPBC16E9.11c      CDS       T00076                                 

Gene name
pub3
Definition
HECT-type ubiquitin-protein ligase Pub3 (predicted)
Orthology
K10591  
E3 ubiquitin-protein ligase NEDD4 [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:spo04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(1935777..1937958,1938301..1938479))
Genome map
AA seq 786 aa AA seqDB search
MEQGAKRVRFYIVAADGLSKRDLFRQPDPFAILTVDGEQTHTTKVIKKSVNPYWNEGFEV
TVKPSSVISIRLFDQKKFKKKDQGFLGLVSFRMREVGSFRSNREVSLTRPLKKSSTTNLS
VLGNLVLKVAPSKIRAPAGNHSSTTANRTTSTPTTTTARTTRTTPRPTATTNTSNQSTSN
STRNGTSAATSNGTGTGAGTGASHRSSPVTNRQTNNTSALSNSNAHIMSSFEDQYGRLPP
GWERRADSLGRTYYVDHNTRTTTWTRPASSTNPVHNTSSDSQRLNHQNRHLPDDSNPSLM
QSDSGNDLPFGWEMRYTDTGRPYFVDHNTRTTTWVDPRNPLVRPNGGSSTVGSLMQPQSL
SHLGPLPSGWEMRLTNSARVYFVDHNTKTTTWDDPRLPSALDQDVPQYKCDFRRKLIYFR
SQPGMRPLPGQCNVKVRRDHIFEDSYAEIMRYSAHDLKKRLMIRFDGEDGLDYGGLSREF
FFLLSHKMFDPIYCLFEYSAVDNYTLQINPHSSINPEHLNYFRFIGRVIGLAIFHRRFLD
AFFVVSLYKKLLRKKVSLADMESIDAEFYRSLKWVLENDITGILDLTFSVEEDHFGEVRT
VELITNGENIEVTEENKKKYVDLVTEWRVSKRVEQQFNAFYSGFVELVSPDLVNVFDERE
LELLIGGISDVDVEDWKSHTEYRTYIATDPVIKWFWEIIAGWKNEDRSKLLQFATGTSRI
PVNGFRDLQGSDGPRKFTIEKAGTPDQLPVAHTCFNRLDLPDYPSKDTLHEKLSLAVENT
VGFGNE
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaggagcgaaaagagtccggttctacatagtagctgctgatggattaagtaaa
cgggatctttttcgacagcccgatccctttgctattttaacggtagatggcgagcaaact
catacaacgaaagttattaaaaaatcggtgaacccttattggaatgaaggatttgaagta
actgttaagccatctagcgttatatccatacgcctttttgatcagaaaaagttcaaaaag
aaagatcaaggcttccttggcttagtatcctttcgtatgcgtgaagttggtagttttcga
tcaaatcgcgaagtgtcgcttactcgaccattgaaaaaatcttccaccactaatctttcc
gttttgggaaatctcgtattgaaggtggccccgtctaaaattagggctcccgccggaaat
cactcatctactacagccaatcgcactactagtacacctacaaccacaactgcacgtact
actcgtactactccccgtccgactgccacaactaatacctcgaatcagtccacttcgaat
tcgactcggaatggcacttctgctgcaacttcaaatgggactggtactggcgctggtact
ggcgcaagtcatcgttctagtcctgtaaccaatcgccagactaacaatactagtgctctt
tcgaattcgaatgcacatatcatgtcatcgtttgaagaccaatatggacgtcttcctcca
ggttgggaacgccgtgctgactctctaggtcgcacttattatgttgatcataatacgcgc
actaccacctggactcgtccggctagcagtacaaatcctgtacataatacgtcgagtgat
agccaaagacttaatcatcagaacagacatttacctgatgactctaatccatctttaatg
caatcagattccggaaacgaccttcctttcggctgggaaatgcgatacacagatacaggc
cgcccatattttgttgaccataatacgcgaactaccacatgggttgatccacgaaatccc
cttgtgcgacctaatggtggctcttctactgtgggtagcttgatgcagccacagtcactt
tcgcatttgggtcccttacctagtggttgggaaatgcgtcttacaaatagtgcccgtgtc
tattttgttgatcacaatacgaaaacaaccacttgggacgatccacgtcttccttctgcc
ttggatcaagatgttcctcaatacaaatgcgattttcgtcgcaaacttatatatttccgt
tcacaacctggtatgcgtcctttacctggccaatgcaatgttaaggtacgcagagatcac
attttcgaagattcatatgcggagattatgcgttattctgctcatgacttgaaaaagaga
cttatgatacgttttgatggtgaagatggtctagattacggtggtttgtctagagagttt
ttcttcctcttatcacataaaatgtttgacccgatttattgcttatttgagtactccgct
gtcgacaattacactctgcagattaatcctcattctagcattaaccctgagcatctcaat
tatttccgtttcattgggcgtgttataggtttggcaatttttcatcgccgttttcttgac
gctttctttgttgtttctctctacaagaaattattacgtaaaaaggttagtctagctgac
atggaaagtatcgatgctgagttttatcgaagcttgaagtgggttttggaaaatgatatc
accggcattttggatttaacattcagcgttgaagaagaccattttggggaagttcgtact
gttgagcttataaccaatggtgaaaacattgaagtcactgaagaaaacaagaagaaatat
gttgatttggttactgaatggagagtttccaaacgtgttgagcaacaatttaatgcattt
tattctggttttgttgaactggtatcccctgatttagtgaatgttttcgacgaaagagaa
cttgaattgttaattggtggtatatccgatgttgatgttgaagactggaagagccacacc
gagtatcgcacttatattgctaccgatcctgttatcaagtggttttgggaaattattgct
ggctggaagaacgaagatcgttcaaagttattacagttcgctacaggcacatcacgcatt
cctgtcaatggttttagggatttgcaaggaagtgatggacctcgcaagtttactattgaa
aaggcaggtacaccggatcaacttccagtagcacacacatgtttcaatcgcttggattta
cctgattatccttcaaaagatacactgcatgaaaaattgagcctagccgttgaaaacacg
gtagggtttggaaacgagtaa

DBGET integrated database retrieval system