KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16G5.02cHelp
Entry
SPBC16G5.02c      CDS       T00076                                 

Definition
ribokinase (predicted) (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPBC16G5.02c
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SPBC16G5.02c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(4216147..4217103)
Genome map
AA seq 318 aa AA seqDB search
MINIVVLGSMNTDLVMRTKICPSGGETIHGEPDGFSTGNGGKGANQAVAVARLSNPADTK
VSMLGCVGDDAFGVEMLSGLKKDGVNVDNVKKIENKSTGVAMIIVEETGENRILLSEGAN
GNVDTAFVKAMEQRISTCNLLIMQLEIPLEAVEIALQIAHKHGVDVLMNPAPAIPLSHDM
ISYCAYLVPNEHEAAILLNQADSPATLENVDAYASKLLSFGVRKAVIITLGSQGAYYKSA
NGESALVSACKVKAVDTTAAGDTFIGAFSNSIAHGQPLKDSLEFAAKCSAITVQRKGAAS
SIPSLLEVDGSFNLKKNT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgattaatatagtcgttttagggagtatgaataccgatctcgtaatgcgtacaaagata
tgtccctcaggtggtgagacgattcatggagaaccagatggcttcagtacaggaaatggt
gggaaaggagctaatcaagctgtagctgttgctaggctatcaaatccggctgatacgaaa
gtatctatgttgggatgcgtaggtgatgatgcctttggggtggaaatgttgtccggattg
aagaaagacggcgtaaatgtagataatgtcaaaaagattgaaaacaagtccacaggtgtt
gccatgattattgtcgaagaaacgggagaaaacagaattttgctttctgagggtgcgaac
ggtaatgttgatactgcgtttgtgaaggccatggagcaaagaatatcaacatgtaatctt
ctaattatgcaattagaaattcctttagaagcagtggaaattgcattgcagatcgctcac
aaacatggtgtcgatgttttgatgaatccagcaccagcgattccgcttagtcatgacatg
atatcttattgtgcctatcttgtacctaacgaacatgaagctgccattctcttaaatcaa
gcagactcacctgctacgttggaaaatgtggatgcatatgcttctaagttactaagcttc
ggtgtccgtaaagccgtaattataacccttggtagccaaggtgcttactataagtctgcg
aacggagaatctgctttggtctcagcatgcaaagtgaaagccgttgacacgactgccgct
ggcgataccttcattggtgccttttctaattcaattgcacacggacagccacttaaggac
tcactggaatttgctgctaaatgtagtgctattactgtacagagaaagggagctgcaagt
tctattccttccttacttgaagtcgatggttcctttaacctaaaaaagaatacatag

DBGET integrated database retrieval system