KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16H5.02Help
Entry
SPBC16H5.02       CDS       T00076                                 

Gene name
pfk1
Definition
6-phosphofructokinase (predicted) (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPBC16H5.02 (pfk1)
   01230 Biosynthesis of amino acids
    SPBC16H5.02 (pfk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPBC16H5.02 (pfk1)
   00030 Pentose phosphate pathway
    SPBC16H5.02 (pfk1)
   00051 Fructose and mannose metabolism
    SPBC16H5.02 (pfk1)
   00052 Galactose metabolism
    SPBC16H5.02 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    SPBC16H5.02 (pfk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPBC16H5.02 (pfk1)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPBC16H5.02 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(2297466..2300294)
Genome map
AA seq 942 aa AA seqDB search
MSGETVHGISCYSVVANTEDTYNQTLDFYQKLGFKKVASFGTSDSDNARVCNESLREDWM
HVAGNNSAESVTIKFRLVPGELSLSPAAEDSEWRGQKSSLVFYYPNLLDLLKQLSADAIK
YQAFPNEKKPDEVYVEDPLGNLIGFSDRYNPFAHANLKKSEESGAASNLESGLATPVVET
LKKATTSDKPAGVKKKIAVMTSGGDSPGMNAVVRAVARIAIHRGCDAFAIYEGYEGLVQG
GDMIKQLQWGDVRGWLAEGGTLIGTARCMAFRERPGRLRAAKNLISAGIDSIIVCGGDGS
LTGADIFRSDWPGLVKELEDTKAITPEQAKLYRHLTIVGLVGSIDNDMSSTDVTIGAFSS
LHRICEAVDSISSTAISHSRAFIVEVMGRHCGWLAVLAALATGADFVFIPERPAEVGKWQ
DELCNSLSSVRKLGKRKSIVIVAEGAIDSELNHISPEDIKNLLVERLHLDTRVTTLGHVQ
RGGIPCAYDRMLATLQGVDAVDAVLASTPDTPSPMIAINGNKINRKPLMEAVKLTHEVAD
AIEKKQFAHAMELRDPEFADYLHTWEGTTFIEDESHFVPKDERMRVAIIHVGAPAGGMNS
ATRAAVRYCLNRGHTPLAIDNGFSGFLRHDSIHELSWIDVDEWCIRGGSEIGTNRDTPDL
DMGFTAFKFQQHKIDALIIIGGFEAFTALSQLESARVNYPSFRIPMAIIPATISNNVPGT
EFSLGCDTCLNAVMEYCDTIKQSASASRRRVFVCEVQGGRSGYIATVGGLITGASAIYTP
EDGISLDMLRKDIDHLKATFALEAGRNRAGQLILRNECASKVYTTEVIGNIISEEAHKRF
SARTAVPGHVQQGGNPTPMDRARAARLAMRAIRFFETCRANDLGNDPSSAVVIGIRGTGV
SFSSVADVENNETEIEMRRPKNAWWRDMHNLVNILAGKTFAD
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaaaccgtgcatggaatttcgtgctactctgttgttgcaaacactgaggac
acatataatcagactctcgacttctaccaaaagcttggcttcaagaaggttgccagcttc
ggtaccagcgattctgacaatgcccgtgtttgcaacgagtctctccgtgaggactggatg
catgtcgctggaaacaactctgctgaaagcgtcaccatcaagttccgtttagtccccggt
gaattgagcctttcccccgctgccgaagattctgaatggcgcggacaaaagagttctctt
gttttttactatcccaacttgcttgacttgcttaagcaactcagtgccgatgccattaaa
taccaagctttccccaacgagaagaagcctgatgaggtttatgtcgaggatcccttgggt
aatttgattggcttctccgaccgttacaatcctttcgcccatgctaaccttaagaagagc
gaggagtctggtgctgcttctaacctcgagagcggtttggctactcccgtcgttgagact
ctcaagaaagctaccacttctgacaagcctgcaggtgtcaagaagaagattgcagttatg
accagtggtggtgactcccctggtatgaacgctgttgttcgtgccgtcgctcgtattgcc
attcaccgtggttgtgatgctttcgctatttatgaaggttatgaaggtcttgttcaaggt
ggtgatatgatcaagcaattgcaatggggtgatgtccgtggttggcttgctgagggtggt
actcttattggtaccgctcgttgtatggctttccgtgagcgtcctggtcgtcttcgtgct
gccaagaaccttatttccgctggtattgattccattattgtttgcggtggtgatggttct
ttgaccggtgctgatatcttccgttctgactggcccggtttggttaaagagttggaggac
accaaggctattactcccgagcaagccaagctctaccgccatcttaccattgtcggtttg
gtcggttcaatcgataacgatatgtcttcaactgacgttactatcggtgccttctcttct
cttcaccgtatttgcgaagccgtcgactccatttcttctactgctatttcccattctcgt
gctttcatcgttgaagtcatgggtcgtcattgcggttggttggctgttttagctgcattg
gctaccggtgctgatttcgtctttatccctgagagacctgctgaagtcggcaaatggcaa
gacgaattgtgcaattctttgagctctgtccgtaagttgggcaagagaaagtcaattgtt
attgttgcagagggtgctattgactccgagcttaaccacatttctcccgaagacatcaag
aacttgttagttgagcgccttcacttggacactcgtgtcaccactctcggtcacgttcaa
cgtggtggtattccttgtgcttatgaccgtatgcttgctacccttcaaggtgttgatgcc
gttgatgctgttcttgcctctacccctgatactccatctcccatgattgctatcaatggt
aacaagattaaccgcaagcctttgatggaggctgttaagttgactcatgaggttgctgat
gctattgagaagaagcagttcgctcatgctatggagctccgtgaccccgaatttgctgat
tacttacacacttgggaaggtactacctttattgaagacgagtcacacttcgttcccaag
gacgagagaatgcgtgtcgccatcatccatgttggtgctcccgctggtggtatgaactct
gctactcgtgctgccgttcgatattgtttgaaccgtggtcacactcctcttgccattgac
aatggtttctctggcttcttgcgccatgattctattcatgaactttcatggattgatgtt
gatgagtggtgcattcgtggtggtagtgaaatcggtaccaaccgtgatacccctgatctc
gacatgggcttcactgccttcaagttccaacaacataagattgatgctttgattattatt
ggtggtttcgaggctttcaccgccctttctcaacttgagagtgcacgtgttaactaccct
tcattccgcattcccatggctatcatccctgccaccatttccaacaacgttcccggtacc
gaattctctttgggttgcgatacttgtcttaatgccgttatggaatactgtgataccatt
aagcaaagtgctagtgctagccgtcgtcgtgtcttcgtttgtgaagttcaaggtggccgc
tctggttatatcgctactgtcggtggtctcattactggtgcctccgccatttacaccccc
gaggatggtatctccttggatatgttgcgtaaggatattgatcaccttaaggctacattc
gccttagaagctggtcgtaaccgtgctggtcaacttatccttcgtaacgaatgtgcttct
aaggtttacaccaccgaagttattggaaacatcatcagtgaagaagctcataagcgcttc
tccgctcgtaccgctgttcccggtcacgttcaacaaggtggtaaccccactcctatggac
cgtgctcgtgctgctcgtctggctatgcgtgccattcgtttcttcgaaacttgccgtgcc
aacgacttgggtaatgaccccagctctgccgttgtcatcggtatccgtggtactggtgtc
tctttcagctctgttgctgatgttgagaacaacgaaaccgaaattgagatgcgtcgtcct
aagaacgcttggtggcgtgatatgcacaacttggttaacatcttggccggcaagaccttt
gctgattaa

DBGET integrated database retrieval system