KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16H5.02Help
Entry
SPBC16H5.02       CDS       T00076                                 

Gene name
pfk1
Definition
6-phosphofructokinase (predicted) (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:spo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:spo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:spo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:spo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(2297466..2300294)
Genome map
AA seq 942 aa AA seqDB search
MSGETVHGISCYSVVANTEDTYNQTLDFYQKLGFKKVASFGTSDSDNARVCNESLREDWM
HVAGNNSAESVTIKFRLVPGELSLSPAAEDSEWRGQKSSLVFYYPNLLDLLKQLSADAIK
YQAFPNEKKPDEVYVEDPLGNLIGFSDRYNPFAHANLKKSEESGAASNLESGLATPVVET
LKKATTSDKPAGVKKKIAVMTSGGDSPGMNAVVRAVARIAIHRGCDAFAIYEGYEGLVQG
GDMIKQLQWGDVRGWLAEGGTLIGTARCMAFRERPGRLRAAKNLISAGIDSIIVCGGDGS
LTGADIFRSDWPGLVKELEDTKAITPEQAKLYRHLTIVGLVGSIDNDMSSTDVTIGAFSS
LHRICEAVDSISSTAISHSRAFIVEVMGRHCGWLAVLAALATGADFVFIPERPAEVGKWQ
DELCNSLSSVRKLGKRKSIVIVAEGAIDSELNHISPEDIKNLLVERLHLDTRVTTLGHVQ
RGGIPCAYDRMLATLQGVDAVDAVLASTPDTPSPMIAINGNKINRKPLMEAVKLTHEVAD
AIEKKQFAHAMELRDPEFADYLHTWEGTTFIEDESHFVPKDERMRVAIIHVGAPAGGMNS
ATRAAVRYCLNRGHTPLAIDNGFSGFLRHDSIHELSWIDVDEWCIRGGSEIGTNRDTPDL
DMGFTAFKFQQHKIDALIIIGGFEAFTALSQLESARVNYPSFRIPMAIIPATISNNVPGT
EFSLGCDTCLNAVMEYCDTIKQSASASRRRVFVCEVQGGRSGYIATVGGLITGASAIYTP
EDGISLDMLRKDIDHLKATFALEAGRNRAGQLILRNECASKVYTTEVIGNIISEEAHKRF
SARTAVPGHVQQGGNPTPMDRARAARLAMRAIRFFETCRANDLGNDPSSAVVIGIRGTGV
SFSSVADVENNETEIEMRRPKNAWWRDMHNLVNILAGKTFAD
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaaaccgtgcatggaatttcgtgctactctgttgttgcaaacactgaggac
acatataatcagactctcgacttctaccaaaagcttggcttcaagaaggttgccagcttc
ggtaccagcgattctgacaatgcccgtgtttgcaacgagtctctccgtgaggactggatg
catgtcgctggaaacaactctgctgaaagcgtcaccatcaagttccgtttagtccccggt
gaattgagcctttcccccgctgccgaagattctgaatggcgcggacaaaagagttctctt
gttttttactatcccaacttgcttgacttgcttaagcaactcagtgccgatgccattaaa
taccaagctttccccaacgagaagaagcctgatgaggtttatgtcgaggatcccttgggt
aatttgattggcttctccgaccgttacaatcctttcgcccatgctaaccttaagaagagc
gaggagtctggtgctgcttctaacctcgagagcggtttggctactcccgtcgttgagact
ctcaagaaagctaccacttctgacaagcctgcaggtgtcaagaagaagattgcagttatg
accagtggtggtgactcccctggtatgaacgctgttgttcgtgccgtcgctcgtattgcc
attcaccgtggttgtgatgctttcgctatttatgaaggttatgaaggtcttgttcaaggt
ggtgatatgatcaagcaattgcaatggggtgatgtccgtggttggcttgctgagggtggt
actcttattggtaccgctcgttgtatggctttccgtgagcgtcctggtcgtcttcgtgct
gccaagaaccttatttccgctggtattgattccattattgtttgcggtggtgatggttct
ttgaccggtgctgatatcttccgttctgactggcccggtttggttaaagagttggaggac
accaaggctattactcccgagcaagccaagctctaccgccatcttaccattgtcggtttg
gtcggttcaatcgataacgatatgtcttcaactgacgttactatcggtgccttctcttct
cttcaccgtatttgcgaagccgtcgactccatttcttctactgctatttcccattctcgt
gctttcatcgttgaagtcatgggtcgtcattgcggttggttggctgttttagctgcattg
gctaccggtgctgatttcgtctttatccctgagagacctgctgaagtcggcaaatggcaa
gacgaattgtgcaattctttgagctctgtccgtaagttgggcaagagaaagtcaattgtt
attgttgcagagggtgctattgactccgagcttaaccacatttctcccgaagacatcaag
aacttgttagttgagcgccttcacttggacactcgtgtcaccactctcggtcacgttcaa
cgtggtggtattccttgtgcttatgaccgtatgcttgctacccttcaaggtgttgatgcc
gttgatgctgttcttgcctctacccctgatactccatctcccatgattgctatcaatggt
aacaagattaaccgcaagcctttgatggaggctgttaagttgactcatgaggttgctgat
gctattgagaagaagcagttcgctcatgctatggagctccgtgaccccgaatttgctgat
tacttacacacttgggaaggtactacctttattgaagacgagtcacacttcgttcccaag
gacgagagaatgcgtgtcgccatcatccatgttggtgctcccgctggtggtatgaactct
gctactcgtgctgccgttcgatattgtttgaaccgtggtcacactcctcttgccattgac
aatggtttctctggcttcttgcgccatgattctattcatgaactttcatggattgatgtt
gatgagtggtgcattcgtggtggtagtgaaatcggtaccaaccgtgatacccctgatctc
gacatgggcttcactgccttcaagttccaacaacataagattgatgctttgattattatt
ggtggtttcgaggctttcaccgccctttctcaacttgagagtgcacgtgttaactaccct
tcattccgcattcccatggctatcatccctgccaccatttccaacaacgttcccggtacc
gaattctctttgggttgcgatacttgtcttaatgccgttatggaatactgtgataccatt
aagcaaagtgctagtgctagccgtcgtcgtgtcttcgtttgtgaagttcaaggtggccgc
tctggttatatcgctactgtcggtggtctcattactggtgcctccgccatttacaccccc
gaggatggtatctccttggatatgttgcgtaaggatattgatcaccttaaggctacattc
gccttagaagctggtcgtaaccgtgctggtcaacttatccttcgtaacgaatgtgcttct
aaggtttacaccaccgaagttattggaaacatcatcagtgaagaagctcataagcgcttc
tccgctcgtaccgctgttcccggtcacgttcaacaaggtggtaaccccactcctatggac
cgtgctcgtgctgctcgtctggctatgcgtgccattcgtttcttcgaaacttgccgtgcc
aacgacttgggtaatgaccccagctctgccgttgtcatcggtatccgtggtactggtgtc
tctttcagctctgttgctgatgttgagaacaacgaaaccgaaattgagatgcgtcgtcct
aagaacgcttggtggcgtgatatgcacaacttggttaacatcttggccggcaagaccttt
gctgattaa

DBGET integrated database retrieval system