KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16H5.02Help
Entry
SPBC16H5.02       CDS       T00076                                 

Gene name
pfk1
Definition
(RefSeq) 6-phosphofructokinase (predicted) (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPBC16H5.02 (pfk1)
   01230 Biosynthesis of amino acids
    SPBC16H5.02 (pfk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPBC16H5.02 (pfk1)
   00030 Pentose phosphate pathway
    SPBC16H5.02 (pfk1)
   00051 Fructose and mannose metabolism
    SPBC16H5.02 (pfk1)
   00052 Galactose metabolism
    SPBC16H5.02 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    SPBC16H5.02 (pfk1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPBC16H5.02 (pfk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPBC16H5.02 (pfk1)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPBC16H5.02 (pfk1)
Messenger RNA biogenesis [BR:spo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SPBC16H5.02 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(2297466..2300294)
Genome map
AA seq 942 aa AA seqDB search
MSGETVHGISCYSVVANTEDTYNQTLDFYQKLGFKKVASFGTSDSDNARVCNESLREDWM
HVAGNNSAESVTIKFRLVPGELSLSPAAEDSEWRGQKSSLVFYYPNLLDLLKQLSADAIK
YQAFPNEKKPDEVYVEDPLGNLIGFSDRYNPFAHANLKKSEESGAASNLESGLATPVVET
LKKATTSDKPAGVKKKIAVMTSGGDSPGMNAVVRAVARIAIHRGCDAFAIYEGYEGLVQG
GDMIKQLQWGDVRGWLAEGGTLIGTARCMAFRERPGRLRAAKNLISAGIDSIIVCGGDGS
LTGADIFRSDWPGLVKELEDTKAITPEQAKLYRHLTIVGLVGSIDNDMSSTDVTIGAFSS
LHRICEAVDSISSTAISHSRAFIVEVMGRHCGWLAVLAALATGADFVFIPERPAEVGKWQ
DELCNSLSSVRKLGKRKSIVIVAEGAIDSELNHISPEDIKNLLVERLHLDTRVTTLGHVQ
RGGIPCAYDRMLATLQGVDAVDAVLASTPDTPSPMIAINGNKINRKPLMEAVKLTHEVAD
AIEKKQFAHAMELRDPEFADYLHTWEGTTFIEDESHFVPKDERMRVAIIHVGAPAGGMNS
ATRAAVRYCLNRGHTPLAIDNGFSGFLRHDSIHELSWIDVDEWCIRGGSEIGTNRDTPDL
DMGFTAFKFQQHKIDALIIIGGFEAFTALSQLESARVNYPSFRIPMAIIPATISNNVPGT
EFSLGCDTCLNAVMEYCDTIKQSASASRRRVFVCEVQGGRSGYIATVGGLITGASAIYTP
EDGISLDMLRKDIDHLKATFALEAGRNRAGQLILRNECASKVYTTEVIGNIISEEAHKRF
SARTAVPGHVQQGGNPTPMDRARAARLAMRAIRFFETCRANDLGNDPSSAVVIGIRGTGV
SFSSVADVENNETEIEMRRPKNAWWRDMHNLVNILAGKTFAD
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaaaccgtgcatggaatttcgtgctactctgttgttgcaaacactgaggac
acatataatcagactctcgacttctaccaaaagcttggcttcaagaaggttgccagcttc
ggtaccagcgattctgacaatgcccgtgtttgcaacgagtctctccgtgaggactggatg
catgtcgctggaaacaactctgctgaaagcgtcaccatcaagttccgtttagtccccggt
gaattgagcctttcccccgctgccgaagattctgaatggcgcggacaaaagagttctctt
gttttttactatcccaacttgcttgacttgcttaagcaactcagtgccgatgccattaaa
taccaagctttccccaacgagaagaagcctgatgaggtttatgtcgaggatcccttgggt
aatttgattggcttctccgaccgttacaatcctttcgcccatgctaaccttaagaagagc
gaggagtctggtgctgcttctaacctcgagagcggtttggctactcccgtcgttgagact
ctcaagaaagctaccacttctgacaagcctgcaggtgtcaagaagaagattgcagttatg
accagtggtggtgactcccctggtatgaacgctgttgttcgtgccgtcgctcgtattgcc
attcaccgtggttgtgatgctttcgctatttatgaaggttatgaaggtcttgttcaaggt
ggtgatatgatcaagcaattgcaatggggtgatgtccgtggttggcttgctgagggtggt
actcttattggtaccgctcgttgtatggctttccgtgagcgtcctggtcgtcttcgtgct
gccaagaaccttatttccgctggtattgattccattattgtttgcggtggtgatggttct
ttgaccggtgctgatatcttccgttctgactggcccggtttggttaaagagttggaggac
accaaggctattactcccgagcaagccaagctctaccgccatcttaccattgtcggtttg
gtcggttcaatcgataacgatatgtcttcaactgacgttactatcggtgccttctcttct
cttcaccgtatttgcgaagccgtcgactccatttcttctactgctatttcccattctcgt
gctttcatcgttgaagtcatgggtcgtcattgcggttggttggctgttttagctgcattg
gctaccggtgctgatttcgtctttatccctgagagacctgctgaagtcggcaaatggcaa
gacgaattgtgcaattctttgagctctgtccgtaagttgggcaagagaaagtcaattgtt
attgttgcagagggtgctattgactccgagcttaaccacatttctcccgaagacatcaag
aacttgttagttgagcgccttcacttggacactcgtgtcaccactctcggtcacgttcaa
cgtggtggtattccttgtgcttatgaccgtatgcttgctacccttcaaggtgttgatgcc
gttgatgctgttcttgcctctacccctgatactccatctcccatgattgctatcaatggt
aacaagattaaccgcaagcctttgatggaggctgttaagttgactcatgaggttgctgat
gctattgagaagaagcagttcgctcatgctatggagctccgtgaccccgaatttgctgat
tacttacacacttgggaaggtactacctttattgaagacgagtcacacttcgttcccaag
gacgagagaatgcgtgtcgccatcatccatgttggtgctcccgctggtggtatgaactct
gctactcgtgctgccgttcgatattgtttgaaccgtggtcacactcctcttgccattgac
aatggtttctctggcttcttgcgccatgattctattcatgaactttcatggattgatgtt
gatgagtggtgcattcgtggtggtagtgaaatcggtaccaaccgtgatacccctgatctc
gacatgggcttcactgccttcaagttccaacaacataagattgatgctttgattattatt
ggtggtttcgaggctttcaccgccctttctcaacttgagagtgcacgtgttaactaccct
tcattccgcattcccatggctatcatccctgccaccatttccaacaacgttcccggtacc
gaattctctttgggttgcgatacttgtcttaatgccgttatggaatactgtgataccatt
aagcaaagtgctagtgctagccgtcgtcgtgtcttcgtttgtgaagttcaaggtggccgc
tctggttatatcgctactgtcggtggtctcattactggtgcctccgccatttacaccccc
gaggatggtatctccttggatatgttgcgtaaggatattgatcaccttaaggctacattc
gccttagaagctggtcgtaaccgtgctggtcaacttatccttcgtaacgaatgtgcttct
aaggtttacaccaccgaagttattggaaacatcatcagtgaagaagctcataagcgcttc
tccgctcgtaccgctgttcccggtcacgttcaacaaggtggtaaccccactcctatggac
cgtgctcgtgctgctcgtctggctatgcgtgccattcgtttcttcgaaacttgccgtgcc
aacgacttgggtaatgaccccagctctgccgttgtcatcggtatccgtggtactggtgtc
tctttcagctctgttgctgatgttgagaacaacgaaaccgaaattgagatgcgtcgtcct
aagaacgcttggtggcgtgatatgcacaacttggttaacatcttggccggcaagaccttt
gctgattaa

DBGET integrated database retrieval system