KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16H5.03cHelp
Entry
SPBC16H5.03c      CDS       T00076                                 

Gene name
fub2, uba2
Definition
SUMO E1-like activator enzyme Fub2 (predicted)
Orthology
K10685  
ubiquitin-like 1-activating enzyme E1 B [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC16H5.03c (fub2)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPBC16H5.03c (fub2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(2295031..2295111,2295153..2295233,2295324..2296382,2296424..2297089)
Genome map
AA seq 628 aa AA seqDB search
MPTLMQLSNDMKPLTFVEALRNFKSAKVLLVGAGGIGCELLKNLLMSGVKEVHIIDLDTI
DLSNLNRQFLFRKKHVKQPKAIVAAKTASSFNPNVKLEAYHANIKEDRFNVAWFRQFDLV
FNALDNLDARRHVNKQCLLASVPLIESGTTGFLGQVQVIIHGKTECYDCNPKEPPKTYPV
CTIRSTPSQPIHCVVWAKSYFFPQLFSNDQESDGIIDNVSANEMERREIAELARETTELN
ELRSSIGQSDNGFEKIFTKMFTKDIVRLREVPDAWTYRSPPKELSYSELLENAEKATSPW
LNEQNVWNVAESFAVLRDSIRRLALRSKSSKDDLSFDKDDKDTLDFVAAAANLRAHVFGI
QQLSEFDIKQMAGNIIPAIATTNAVIAGLCITQAIKVLQGDLNDLKNIYLAKRPTRVLHC
EKTCKPNPYCPTCSFVLLQLGVNDKNMTLRVLVDDILKSRLHYSEEVSVLNDKLIYDPDF
DDNLDKTFDDLGINPAKNTILTVLGDSAVEKDDDGEEATRVPLLIEVTFIDSNSTEGLPY
QILSNATSIPLKQQPPSNSPEDSQVLTDEINEVNDFSSSERIVINLDEYDIIVDSKTSSH
NKQLKRRPSNDTLTQEAKSKKQAKIHTM
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctaatgcaactcagcaacgatatgaaaccattgacatttgtggaggcctta
cgaaatttcaagtctgccaaggtccttttagttggagcgggtggaattgggtgtgaattg
ttaaagaaccttcttatgtcaggagttaaagaagttcatataatcgatcttgatactatt
gatttgtctaatcttaacagacaatttctttttcgtaaaaagcatgtcaaacaacctaag
gcaatcgttgctgcaaaaaccgcaagctcatttaacccaaatgtaaagcttgaagcttat
catgcaaatataaaagaagaccgatttaatgttgcttggtttcgtcaatttgatcttgtt
tttaacgcactagataacttggatgctcgtagacatgtgaataaacaatgcttacttgct
tctgtacctttgattgaaagtggaacaaccggatttcttggccaggtacaggttatcatt
catggcaaaactgaatgttacgactgtaatcccaaagagcctcctaaaacttatccggtt
tgtaccattcgaagcacaccaagtcaaccgattcattgtgtagtttgggcaaaaagttat
ttcttcccccaactttttagtaatgatcaagaaagtgatggaatcattgacaatgtttct
gcaaacgaaatggagagacgtgaaatcgcagaactagctagagaaacaactgagctaaac
gagcttaggtcgtcaattggtcaaagtgacaatggttttgaaaaaatatttacgaaaatg
tttactaaagacatagttcgactccgcgaagtccctgacgcatggacatatcgttctcct
ccaaaagaactttcatactcggaacttttagagaatgccgaaaaagccacttcaccttgg
cttaatgaacaaaatgtttggaatgttgctgaaagttttgcagttctcagagatagcatt
agacgccttgctttaaggtctaaatcctcaaaagacgatctttcttttgacaaggatgat
aaggatacattggattttgtagcagcggcagctaatttgcgtgcccatgtatttggaatt
caacaactctctgaatttgacattaaacaaatggctggcaatattattcctgctatcgca
accacaaatgcagtcatagctggactatgtatcacgcaagctatcaaggttcttcaagga
gatctcaatgatctaaaaaatatatacttggctaaaaggcctaccagagtactccattgc
gagaaaacttgtaaacctaacccttactgtcctacttgttcttttgtacttttacagctt
ggagtaaatgacaaaaatatgactctaagagttcttgttgatgatattttgaaaagtcgt
ttgcattactcagaagaggttagcgttttaaacgataagctgatatatgatcctgacttt
gatgataacttggataaaacttttgatgatttgggtataaatcctgccaaaaatactatt
ctcacagttcttggtgattctgctgtcgaaaaggatgatgatggcgaggaagctactagg
gttcccttgttaattgaagttacattcattgattctaattccaccgaaggattaccttac
caaatactttcaaatgctaccagcattcctcttaaacagcaacctccttcaaattcgcca
gaagattcacaagttttaaccgacgagattaatgaagttaatgacttctcttcgtcggaa
agaatcgttattaatcttgatgaatatgacattattgtcgattctaaaactagcagtcat
aacaaacaactcaaacgtcgaccatctaacgatacacttactcaagaagcaaaatcgaaa
aagcaagcgaaaatacacactatgtaa

DBGET integrated database retrieval system