KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1703.12Help
Entry
SPBC1703.12       CDS       T00076                                 

Gene name
ubp9
Definition
ubiquitin C-terminal hydrolase Ubp9
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPBC1703.12 (ubp9)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPBC1703.12 (ubp9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(2936211..2936237,2936282..2936389,2936439..2936452,2936510..2938118)
Genome map
AA seq 585 aa AA seqDB search
MSLLRWMGMNSPGSTDRRKSTWEAELPKPSIRPETLTDRFYGLTNYGNTCYVSSVLVSLY
HLKPFRDSLNSYPLPSAPPNFKSVCTKTNHPESSSSRHSKKKSMENRKSSLYGSNGINSC
GCVDISNVGSESGTKHQIVVGESNCSAYGMKENIYTCLKDLYCSVSCCDCRYGICSPERF
IQVLRRDNEAFRSTQQQDAHEFFNFLLNSVTETLDEYYGNHSDVMHPKWVHSLFEGTLTS
ETKCLTCENITSRDESFLDLSIDIENHTSVTSCLRSFSASEMLSSKNKFHCDVCKSLQEA
EKRMKIKKLPKILSLHLKRFKYNETQEGHDKLFYTIVFTNEMRLFTTTEDAENAERMYYL
SSVIVHVGGGPHRGHYVSIVRTKTYGWVLFDDENVTPVNENYLQRFFGDQPGQATAYVLF
YTAADEEDDDVSEVDTKESIKPMSIPSQLKQESVEVSNLSSTPRSNSTITYPDMDPMVAS
FSSQYSHKTLDRDINSRSYFDREPSLDAERFHSRSVDASPKAVRRESRSFFPSLTRKRSK
FFGSSQSNSPKDSPLRDTHKSSDEHSESKHSHTLPWQFSRSRSKR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcttcgttggatgggaatgaattccccaggctccactgaccggcgtaaaagc
acttgggaagcagagttgccgaagccatcaattcgccctgaaaccctaacagatcgattc
tatggtttaacaaattatggaaatacatgttacgtgagttctgtcttagtatctttatac
catttaaagccctttcgtgattctttaaattcgtatcctcttccgagtgctcctccaaat
tttaaaagcgtttgtacaaaaaccaaccatcctgaatcatcttcctcacgacacagtaag
aaaaagagcatggagaataggaagtcctctttatacgggtccaatggtataaattcttgc
ggctgtgtcgatattagtaacgtcggctctgaatccgggacgaagcatcaaatcgttgta
ggcgaaagcaattgttctgcttatggaatgaaagaaaacatatatacttgtttaaaggat
ctttattgctccgtaagttgctgtgattgtcgttatggtatttgttctcccgagcgtttt
atccaagttctacgtagagacaatgaagcttttcgcagtactcagcagcaagatgctcac
gagttttttaattttcttcttaattctgttacagaaactcttgatgaatactacggtaat
cattccgacgtgatgcatccaaaatgggttcattctttgtttgaaggaacgcttaccagc
gagacgaaatgtttaacttgtgaaaacataacgtcaagggatgaaagctttttagacctt
agcatagatatagaaaatcacacttctgtaacttcctgtttaaggtctttttctgcttca
gagatgttgtcctccaaaaataagtttcattgtgatgtttgcaaaagtttgcaggaagca
gaaaaaagaatgaagataaaaaaattaccgaaaatcctctcattacatttgaaacgtttt
aaatataacgaaacccaggagggccatgataaactcttctatactattgtttttaccaac
gaaatgagattatttactaccaccgaagatgcagagaatgctgaaagaatgtattatctt
tcctctgttattgttcacgtaggaggcggtccacatcgtggtcattatgtgtctatcgtt
cgcactaaaacttatggctgggtcctttttgatgacgagaacgtaactcctgtcaacgag
aattacctacaacgattttttggtgatcaacctggtcaggctactgcctatgttctattt
tatactgctgctgatgaagaagatgatgatgttagtgaagtagacaccaaggaatcaatt
aagccgatgtctattccaagtcaacttaaacaagaaagcgtggaagtttcgaatctatca
agtacccctagatcaaactcgacaataacatatcctgatatggatccgatggttgcttca
ttttcttcgcagtattctcataaaactttagatagagacatcaatagccgttcttatttt
gatcgtgaaccatcactggatgcagaaagatttcattcaagatctgttgatgcttctcca
aaagccgtacgtcgcgaaagtcgttcgtttttcccttcccttacacgaaaaagaagtaaa
ttttttggatcatcccaaagcaactcccctaaagattcaccattaagggatactcacaag
tctagtgatgaacattcagagtcgaagcactcacatacgcttccttggcaattctctaga
agccgttccaaaaggtaa

DBGET integrated database retrieval system