KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1709.18Help
Entry
SPBC1709.18       CDS       T00076                                 

Gene name
tif452, SPBC409.01
Definition
translation initiation factor eIF4E 4F complex subunit
Orthology
K03259  
translation initiation factor 4E
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPBC1709.18 (tif452)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SPBC1709.18 (tif452)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SPBC1709.18 (tif452)
Translation factors [BR:spo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SPBC1709.18 (tif452)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1134499..1134975,1135066..1135205,1135263..1135377)
Genome map
AA seq 243 aa AA seqDB search
MADAEDSRHSKNEGFPNTSLITEKLDLLDLFGSPKVKTEREGRPARLLEGLSAVNAETAF
VKTHPLQHEWTLWFLKPPTQGLEWSDLLKEIISFKTVEEFWGIFKTISKASMLPAKSDYS
YFLKGIRPEWEDPQNMNGGKWAYQSKHKGSNLDELWLYMVLAAIGETLDPTGKEVTGVVC
NMRKGFYRIAVWTRNCNDKDVLEKIGLRFKEVLGISDKETIEYSAHEDSSKAGSMRAKTR
MSL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgcagaagactcgcgtcactcaaaaaatgagggttttcccaacacttcctta
atcacagaaaaactagatctattggatttatttgggtcaccaaaagttaaaactgaaaga
gagggacgtccagcgcgccttcttgaaggtctatcggctgttaatgctgaaactgcattt
gtaaaaacacacccccttcagcatgaatggacattgtggtttttgaaaccacctacacaa
ggtcttgaatggagtgatcttcttaaagagattatttccttcaagacagtggaagagttt
tggggcatctttaagacgatctcaaaagcttcgatgcttcccgccaaatcggactactct
tactttttgaaaggtattcgtcctgaatgggaggatcctcaaaacatgaatggtgggaaa
tgggcctaccaaagcaagcacaaaggttcaaatctcgacgagttgtggctgtatatggtg
ctggcagccattggagaaacattagaccctactgggaaagaagttactggtgtagtttgc
aatatgaggaaaggattctatagaatcgctgtatggacacgaaattgtaatgacaaagat
gttttggaaaaaatcggcctgcgctttaaagaagttttagggatttctgataaagagact
atagaatatagtgctcatgaggattcatcaaaggctggtagtatgcgagcaaaaacccgt
atgagtctttaa

DBGET integrated database retrieval system