KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1711.13Help
Entry
SPBC1711.13       CDS       T00076                                 

Gene name
his2
Definition
histidinol dehydrogenase His2 (predicted) (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:spo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:2159917..2161236
Genome map
AA seq 439 aa AA seqDB search
MPEYEIQVPSYRAAALTAEERTRLLARPIQNTQKIRTIVQPIIEDVKSRGEASLIDYASK
FEKVQLKSAVLKAPFDDDLMKISPMIKEDIDIAFNNIFAFHSSQLRPTIAVQTMRGVVCQ
RMSRPINRVGLYIPGGTAVLPSTALMLGVPAKVAGCPHVVISTPVRKDGTVAPEIVYIAN
KIGAEAIILAGGAQAIAAMAYGISGVPKVNKIFGPGNQFVTAAKMHVQNDYGALVAIDLP
AGPSEVLVIADETCNPESVALDLLSQAEHGLDSQIILLTVSLSPEMFDRIQKAINDHALR
LSRSYIIKHAIKKSVIVQVDNVDQAFEWSNLYGPEHLVLHLKNASSYIPKIDNAGSVFVG
PWSPVSMGDYASGTNHTLPTYGYASSYSGVSTDSFLKYITTQELTEEGIQRLGPTVIRLA
ELEGLTAHADAVRVRGVRL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatacgagattcaggtgccttcttatagagctgctgcattaaccgccgaagaa
cgtacacgattacttgcaagacccattcagaacactcaaaaaattcgtacgattgtccaa
ccgataatcgaggatgttaaatcaagaggagaagcttctctaatagattatgcttccaaa
tttgaaaaggttcaattgaagtcggctgtcttaaaggctccgtttgacgacgacttaatg
aaaatatccccaatgattaaagaggatattgatattgcttttaacaatatttttgctttc
cattcatcacagctgcgtcctacaattgctgttcaaaccatgcgtggtgtagtctgtcaa
cggatgtctcgtcctattaaccgagttggtctttatatccctggaggaactgcagtgttg
ccatctactgctttgatgcttggagttccggcgaaggtagctggctgtcctcatgtagtg
atttctacgccagtccgaaaggatggtacggttgcgcctgaaattgtatatattgcaaat
aaaattggtgctgaggctattattttggcaggcggggcgcaagcaattgcggccatggca
tatggaatatccggtgttcctaaagttaacaaaatttttggccctggaaatcaatttgtt
acagctgcaaagatgcatgttcagaatgattacggggctttagttgctattgatcttcct
gctggtccctcagaagttttggtaatagcagatgagacctgtaatcctgaaagtgttgcc
ttggatttattgtctcaagcagagcatggtttggacagtcagatcattttgctgactgtc
tctctatctcccgaaatgtttgaccgtattcaaaaagcaattaatgatcacgctttacga
ctttctcgttcgtatatcatcaaacatgctatcaagaagtcggttattgtacaggttgac
aatgttgatcaagcttttgaatggtctaatttgtatggtcctgagcacttggtcttgcac
ttaaaaaatgcttcttcatacattcccaaaatagataatgctggtagcgttttcgttggt
ccttggtcacctgtaagtatgggtgactatgcgtctggtaccaaccatacgcttcctaca
tacgggtacgcctcttcttattctggcgttagtaccgatagcttcttaaaatatatcact
acccaagagctcactgaagaaggaatccagcggttgggccctactgttattcgtcttgct
gagttggagggtctcactgcgcatgccgatgctgttcgtgttcggggagttagactttga

DBGET integrated database retrieval system