KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1711.13Help
Entry
SPBC1711.13       CDS       T00076                                 

Gene name
his2
Definition
histidinol dehydrogenase His2 (predicted) (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPBC1711.13 (his2)
  Amino acid metabolism
   00340 Histidine metabolism
    SPBC1711.13 (his2)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SPBC1711.13 (his2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:2159917..2161236
Genome map
AA seq 439 aa AA seqDB search
MPEYEIQVPSYRAAALTAEERTRLLARPIQNTQKIRTIVQPIIEDVKSRGEASLIDYASK
FEKVQLKSAVLKAPFDDDLMKISPMIKEDIDIAFNNIFAFHSSQLRPTIAVQTMRGVVCQ
RMSRPINRVGLYIPGGTAVLPSTALMLGVPAKVAGCPHVVISTPVRKDGTVAPEIVYIAN
KIGAEAIILAGGAQAIAAMAYGISGVPKVNKIFGPGNQFVTAAKMHVQNDYGALVAIDLP
AGPSEVLVIADETCNPESVALDLLSQAEHGLDSQIILLTVSLSPEMFDRIQKAINDHALR
LSRSYIIKHAIKKSVIVQVDNVDQAFEWSNLYGPEHLVLHLKNASSYIPKIDNAGSVFVG
PWSPVSMGDYASGTNHTLPTYGYASSYSGVSTDSFLKYITTQELTEEGIQRLGPTVIRLA
ELEGLTAHADAVRVRGVRL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatacgagattcaggtgccttcttatagagctgctgcattaaccgccgaagaa
cgtacacgattacttgcaagacccattcagaacactcaaaaaattcgtacgattgtccaa
ccgataatcgaggatgttaaatcaagaggagaagcttctctaatagattatgcttccaaa
tttgaaaaggttcaattgaagtcggctgtcttaaaggctccgtttgacgacgacttaatg
aaaatatccccaatgattaaagaggatattgatattgcttttaacaatatttttgctttc
cattcatcacagctgcgtcctacaattgctgttcaaaccatgcgtggtgtagtctgtcaa
cggatgtctcgtcctattaaccgagttggtctttatatccctggaggaactgcagtgttg
ccatctactgctttgatgcttggagttccggcgaaggtagctggctgtcctcatgtagtg
atttctacgccagtccgaaaggatggtacggttgcgcctgaaattgtatatattgcaaat
aaaattggtgctgaggctattattttggcaggcggggcgcaagcaattgcggccatggca
tatggaatatccggtgttcctaaagttaacaaaatttttggccctggaaatcaatttgtt
acagctgcaaagatgcatgttcagaatgattacggggctttagttgctattgatcttcct
gctggtccctcagaagttttggtaatagcagatgagacctgtaatcctgaaagtgttgcc
ttggatttattgtctcaagcagagcatggtttggacagtcagatcattttgctgactgtc
tctctatctcccgaaatgtttgaccgtattcaaaaagcaattaatgatcacgctttacga
ctttctcgttcgtatatcatcaaacatgctatcaagaagtcggttattgtacaggttgac
aatgttgatcaagcttttgaatggtctaatttgtatggtcctgagcacttggtcttgcac
ttaaaaaatgcttcttcatacattcccaaaatagataatgctggtagcgttttcgttggt
ccttggtcacctgtaagtatgggtgactatgcgtctggtaccaaccatacgcttcctaca
tacgggtacgcctcttcttattctggcgttagtaccgatagcttcttaaaatatatcact
acccaagagctcactgaagaaggaatccagcggttgggccctactgttattcgtcttgct
gagttggagggtctcactgcgcatgccgatgctgttcgtgttcggggagttagactttga

DBGET integrated database retrieval system