KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1718.01Help
Entry
SPBC1718.01       CDS       T00076                                 

Gene name
pop1, SPBC2G2.18, ste16
Definition
cullin 1 adaptor protein Pop1
Orthology
K03361  
F-box and WD-40 domain protein CDC4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-CDC4 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC1718.01 (pop1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBC1718.01 (pop1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     SPBC1718.01 (pop1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:3469343..3471670
Genome map
AA seq 775 aa AA seqDB search
MNEKKKDSLSVLDSNEFFGETTMVSPSIDVSSSPRPNVERFSPCSTKKDLLEGNNIMTRI
PEELSRVSLQFDSKGSQQSMIFTNNRCLSDKENLENLQNLLYLHCDLNRPHLSCELPSEH
REKCLKRRNSSLSSNLHANKRFLFNSQSDGNKKNETFPSTNYSNVFYPNNCDSKEVASET
TFSLDAPNNSVNYSYFSPNLLGNDSKTRQSFPPHSSSSSHNSLHEPVIYDFSSENPSIHP
SNHLSSQKNAVLKLAQLISSFEKLPESVRQYLLFHLLSRCGKHAVQNIHKILLPIFQKNF
LTGFPAEITNLVLTHLDAPSLCAVSQVSHHWYKLVSSNEELWKSLFLKDGFFWDSIDSKI
RTMCLEQSLSACAIMKRVYFRHFNLRERWLHAPEKIKRCSFPIHGVRLITKLQFDDDKII
VSTCSPRINIYDTKTGVLIRSLEEHEGDVWTFEYVGDTLVTGSTDRTVRVWDLRTGECKQ
VFYGHTSTIRCIKIVQGNQSTTDTDDVEKENRPASNDANSMPPYIISSSRDCTIRLWSLP
CLDDPPFVNVNENPDQNNDFTSATTNPFYIRTLRGHTDSVREVACLGDLIVSASYDGTLR
VWKASTGVCLHVLRGHVGRVYSVTINPSRQQCISAGTDAKIRIWNLESGELLQTLHGHSN
LVSQVTFNQNILVSASAPPDTSLRVWDLNTGSCRDILKCPLGHIFFQHDESKVVSGSHST
LQLWDIRSGKLVRDLLTDLDIIWQVAYNENVCVAAVLRNNRFWIEVLEFGSTKSS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaagaaaaaagatagcctatctgttttagattccaatgaatttttcggtgag
acaactatggtatcaccgagtattgatgtttcctcttctccccggccaaatgtcgagaga
ttttctccatgttccactaaaaaagatctcctggaaggaaataatataatgaccagaatt
cccgaggagcttagtcgtgttagtctacaatttgatagcaagggaagtcagcaatcgatg
atatttactaacaatcgatgtttatctgataaagaaaatttggaaaacttgcaaaatctt
ttatatctacattgtgatcttaaccggccccatttgagttgtgagctgccgtcagagcat
cgcgaaaagtgccttaaacgccgtaactctagtctcagctctaatttgcatgctaataag
cggtttctcttcaattctcaaagtgatgggaataaaaagaatgaaacttttccttctact
aactactcgaacgttttctacccaaacaactgtgacagtaaggaagtcgctagtgaaaca
acattctcacttgatgcaccaaataattctgttaattactcttatttttctcctaattta
ctcggcaacgattccaaaacccgtcaatcttttccccctcattcatcttcatcttcacat
aattctttgcatgaacctgtcatatatgatttttcttcagaaaatcctagcattcatcct
tctaatcatttgagctctcaaaaaaatgctgttttgaaattagcacaattaatttcttcc
ttcgaaaaattacccgaaagtgttcgtcaatacttactttttcatcttctttctcgatgt
ggaaaacatgctgttcaaaatattcacaaaattctgcttcctatctttcaaaagaacttt
ttaactggatttccggctgagattacaaatttagtgcttacgcatttagatgcaccttca
ttgtgtgcagtttcgcaagtttcgcatcactggtataagttggtatcgtccaacgaagaa
ctttggaaaagtctctttttaaaagatggtttcttttgggattcaattgatagtaaaatc
cgtacgatgtgtttagaacaatctttgtcagcctgtgcgataatgaagcgggtctatttt
agacattttaatcttcgtgaaagatggctccatgccccggagaaaattaagcgatgttca
ttcccaattcatggagttcgtcttattaccaaacttcagtttgatgatgacaaaataatt
gttagcacctgcagtcctagaattaatatatatgacacgaaaacaggtgtcctgatacgc
agtttagaagagcatgaaggtgatgtttggacttttgaatacgttggggatactttggtt
actggctccacagacaggacagtaagagtctgggaccttagaaccggtgaatgtaaacag
gtgttttatggacacacgtcaacaatccgttgtatcaaaatagttcaaggcaatcaaagt
actactgatactgatgatgtggaaaaagaaaacagaccagcttcaaatgatgctaattca
atgcctccgtatataatttcaagttcaagggattgtacgatccgtttatggagtcttcca
tgccttgacgatccaccatttgttaatgtaaatgaaaatcctgatcagaataatgacttt
acttcagctacgaccaatccgttttacatccgaacattacgtggtcatacggactcggta
cgtgaagttgcttgtcttggagatttgattgtcagtgccagttatgatggtactcttaga
gtatggaaggcatctactggcgtttgtttacatgttcttcggggacacgtcgggagagta
tacagtgtcacaattaatccttctcgtcaacaatgtatcagcgctggtacggatgctaaa
attcgtatttggaaccttgagtctggagaacttctacagacccttcatggtcattcgaat
ttggtaagtcaagttacatttaaccaaaatatcttggtatccgcttctgctcctcctgat
acatcgttgagagtttgggatctaaacaccggaagttgtcgagatattttaaaatgtcct
ttgggacacatattttttcaacacgacgagagcaaagttgtcagtggaagccatagtacg
ctacagttatgggacattcgttccggaaagttagtaagagacctattgactgatttggat
ataatctggcaagttgcttataatgaaaatgtatgtgtggctgctgttttaagaaataac
cgtttttggatcgaggtcctagagtttggatctactaaatcttcttga

DBGET integrated database retrieval system