KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1734.03Help
Entry
SPBC1734.03       CDS       T00076                                 

Definition
folic acid synthesis protein (EC:2.7.6.3 2.5.1.15 4.1.2.25)
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:1064200..1066401
Genome map
AA seq 733 aa AA seqDB search
MKSLVNLWGIYPFIRNNSLHGFAKIPRIVSTIPRQLRFSSLRHPTRQMDLIHDTVVVENL
NTFAVVGQDQWKRKEPQPVQIDVYMRNNVQLAGEKDELKSTIHYGIASKLLRKEIEGSFF
TTPKDLVNKIASLCFEDVIDTSHVSIKLTLPKCVLRSKNGLHYYAERERNSTSNFVDRIE
FSDLELATILGIHAFERQEKQRVCLNISFANTEVEALEIARAIAEYVEQSAFLTIEALVV
NLSKYLCFTKNLDDISIKAEKPSAITFANASAVQIYRTRSYFLQESLHKYESTKNKIAYL
SFGSNIGDKFEQIQTALSMLHKIEGIRVLDVSPLYETEPMYYKDQPSFLNGVCKIETRMS
PINLLRACQSIEQEMGRIKTILKGPRCIDLDIVLYEDCVYESEVLTIPHLGLQEREFVLR
PLLALSPDLVHPYTHQPLQEALDKLPSQGIRLYSSFDNKKIINGALTMGILNVTPDSFSD
GGKVSQNNILEKAKSMVGDGASILDIGGQSTKPGADPVSVEEELRRVIPMISLLRSSGIT
VPISIDTYYSKVAKLAIEAGANIINDVTGGMGDEKMLPLAASLQVPICIMHMRGTPETMK
ALSIYEKDIVEEVAVELSSRVEAAVQSGVHRYNIILDPGFGFAKTPKQSAGLLGRLHELM
KKPQFKDMHWLSGPSRKGFTGYFTGDASPKDRIWGTSACVTASVLQGVSIVRVHDTKEMS
KVVGMANAIRYVP
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttagtaaacctttggggaatctatccattcattagaaataattctctccat
ggttttgccaaaatacctagaatagtcagcactatccccagacaactccgcttctcatct
ctacgacatcctactagacaaatggacttgatacatgacactgtcgtagttgaaaatctt
aacacatttgctgtagtgggtcaagaccaatggaaaagaaaggaacctcagccagtgcaa
attgatgtatatatgagaaacaatgttcagttagctggagaaaaagacgagttaaaatca
acgattcattacggtatagcttctaagctattacgaaaagaaattgaagggtcttttttt
acaacccctaaagatttggtcaataaaattgcaagtttatgttttgaagacgttattgat
acctcgcatgtttctattaagcttactttacccaaatgtgttttaaggtctaaaaatgga
ttgcactattatgctgagcgcgaacgcaattctaccagtaactttgtagatcgtattgaa
ttctcggatttggagttagctacgatattaggaattcacgcatttgaacgacaagagaag
caaagagtttgcttaaatatatcatttgcaaatacggaggtcgaagctttagagatcgcg
cgcgcaatcgccgaatatgtcgaacaatctgctttcctgactatagaagctttggttgtc
aatctttcaaagtatctttgttttacaaagaatctagacgatataagcattaaagctgag
aaacctagtgctatcacattcgccaatgcttctgcggtgcaaatttatcgaacacggtcg
tactttttacaagagtctctgcataaatacgaatccactaagaacaaaattgcttatttg
tcttttggttcaaatattggtgacaaatttgagcaaatccaaacagcattatctatgttg
cataaaatagagggtattcgtgtgttggatgtttcccctttgtacgaaacagagccgatg
tattataaagaccaaccttcttttttgaacggtgtttgcaaaattgaaaccagaatgtcg
cctatcaatcttttaagagcttgtcaatccattgaacaagaaatgggtcgaatcaaaaca
attttaaaaggaccaaggtgtatagatctcgatattgtcttgtacgaagattgtgtttat
gaatcagaagttttgactattccccatttagggctgcaagaacgtgagtttgttttacgt
ccattgctggccttgagcccagacttagtacacccttatacccatcagcccttacaagaa
gctcttgataaattgccttcacaaggaataagattgtactcatcttttgacaacaaaaaa
atcattaatggcgccttaacaatgggaattttgaacgtgacccccgactcgttttctgat
ggtggtaaagtctcgcagaataatatccttgaaaaagcaaaaagtatggttggagatggt
gcttctatcctagatataggtgggcagtctactaaacctggagctgatcccgtgtctgtt
gaggaagaactcagaagagtaatacctatgattagtttacttcgaagctcagggattaca
gtacccatcagtatcgatacttattattcaaaagttgcaaaactagccattgaggcaggt
gctaatattattaatgatgtgactggagggatgggtgatgagaaaatgttaccattagct
gcaagtttacaggtgcccatttgtattatgcatatgagagggacaccagaaactatgaaa
gcactttcaatatatgaaaaagatatcgttgaagaagttgctgtcgagttgtcgtctcgc
gtggaagctgcggttcagtccggcgttcatcgatacaatattatactggatcctggcttt
ggatttgcaaaaacacctaaacaaagtgccggtttattaggaagacttcatgaactgatg
aaaaaaccgcagtttaaagatatgcattggctttcgggtccaagccgtaaagggtttact
ggttactttactggagacgctagccccaaagaccgtatatggggtacttcagcttgtgtt
acagctagtgttttacaaggagtaagtattgtacgtgtacatgacactaaagaaatgtct
aaagtcgttggtatggctaatgctatacgttacgtaccttaa

DBGET integrated database retrieval system