KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1861.07Help
Entry
SPBC1861.07       CDS       T00076                                 

Definition
elongin C (predicted)
Orthology
K03872  
transcription elongation factor B, polypeptide 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC1861.07
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECV complex
    adoptor protein
     SPBC1861.07
   ECS complex
     SPBC1861.07
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(4144684..4144789,4144830..4144878,4144922..4145055,4145094..4145098)
Genome map
AA seq 97 aa AA seqDB search
MEKEYVRLISGDGFVFILEKEIACLSGTIRAILNEGIFSEAQKNECTFPDIRATLLEKVC
EYLHYNYRYKNQLDIPKFDIPPEMVLELLVTAEYLEA
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaatacgtgagacttatatctggcgacggctttgtgtttatattagaaaaa
gaaattgcttgtctttcaggaacgatacgtgctattctcaacgaaggaatattttctgag
gcgcaaaaaaatgaatgcacatttcctgatatacgggcaacactgttggaaaaagtttgt
gaatatttgcattacaattacagatataaaaatcaattagatattccaaagttcgatatc
ccacctgagatggttttagaattattggtcactgcggaatatttggaagcataa

DBGET integrated database retrieval system