KEGG   Schizosaccharomyces pombe (fission yeast): SPBC18H10.08cHelp
Entry
SPBC18H10.08c     CDS       T00076                                 

Gene name
ubp4
Definition
ubiquitin C-terminal hydrolase Ubp4
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SPBC18H10.08c (ubp4)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPBC18H10.08c (ubp4)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPBC18H10.08c (ubp4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(1784219..1785748,1785937..1786080,1786141..1786248))
Genome map
AA seq 593 aa AA seqDB search
MSDDYFDRLFELAFVYINEDETIQSCSFRGQRWLEEAQTLEQKNSLLKAYYYYLKALKLA
YEIPCRFEISVKSTHYGEFKQFQKLAIQAVSKAFTIKSKLAVKHYLPVIQISDALSLSKK
SSLKVLFLNFYSQESSKGYVFSKHTIAIPISCLQSMDSSKIYDFLKSAPFHPSMVICYSL
ERYFEDVSLAYKLYSMLRSLKLDPHFMELANPKKVDSSLSYENYQPIGLTNLGNTCYMNC
VLQCLFACKDLTIPMLQGRGLLQNINTKNPLGTGGKITSAFFSLLQSVLLNHGQRSISPR
NFLEIVQSLNRDFSIDGQCDAQEFLNFFLDKLHEDLNSNASRSPIAPLTEDQLSAREELP
LSHFSHIEWNLHLRSNKSIVVNNFVGQLCSRTQCMTCGRTSTTFAPFTSLAIPIDDVSHV
VSLQECLLKFSAPELLQGHDGWHCPVCKVQRSAKKVIMISKLPEYLIIQIQRFKISVMGR
KKIDTPLGLSLQIPSKMLVPPSFQSGIGYIPSNYNLFAFICHYGQLENGHYISDVLFNNE
WCHIDDSIVRTVGGITDLREDFSSSYILFYKRSSLLEEFEDKCPKMTLKRNVK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgattatttcgacagactatttgaattagcattcgtttatattaatgaagat
gaaacgattcaaagctgttccttcagaggacaacgctggcttgaagaggcccaaactctt
gaacaaaaaaattcattactcaaagcatactattactatttaaaagcactaaaacttgct
tacgaaattccatgccgattcgagatttctgttaagtctactcattatggagaattcaaa
cagttccaaaagttagcaattcaagccgtttccaaagcctttactataaaaagcaaatta
gcggtgaagcattatttgcctgtaattcaaatctctgacgctctttccctatcaaaaaaa
tcatcacttaaagttctttttcttaatttctattcccaagagtcttcaaagggttatgtt
ttttcgaagcacacgattgccatcccaatatcctgtttgcaatcgatggattcttcaaaa
atatatgactttttaaaatccgcaccttttcatccaagcatggttatttgttacagtttg
gaaagatacttcgaagacgtttctttggcttacaagctttactcgatgttacgttcgttg
aagttggatcctcatttcatggaattggcgaaccctaagaaagttgatagttctttatcg
tatgaaaattatcagcctataggtttaacgaatttgggtaatacttgttacatgaattgt
gtcctgcaatgtctttttgcgtgtaaggacttgactattcctatgttacaggggagagga
ttgcttcaaaatatcaataccaaaaatccattgggtaccggtggaaaaatcacatctgct
ttcttttccttgcttcaaagtgtcttattaaaccatggtcagagatcaatatctccaagg
aattttttagaaattgtacagtcattgaatagagatttctccatcgatggccaatgcgat
gctcaagaatttttaaatttctttcttgataaacttcatgaagatttgaactccaatgca
tctcggtctccgatagcaccgttgacggaagatcaattaagtgccagagaagaactccca
ttgtcccacttttcacacattgaatggaacttgcatctccggtctaacaagagtattgtg
gtcaacaattttgtaggtcaactttgcagtcgtactcaatgtatgacatgtggccgcaca
tctactacttttgctcccttcacatcgcttgcgataccgattgacgatgtctcccatgta
gtaagcctacaagaatgcttattaaaattttcagctcctgaactcttgcaagggcatgat
ggatggcattgtcccgtgtgcaaggttcaaaggtcggcaaaaaaagtaattatgatttcg
aaactacctgaatatttgatcatacaaattcagagatttaaaatatccgtaatgggtcgt
aaaaaaattgatacaccacttggattgagcttacagattccaagtaaaatgctggtacca
ccgagtttccaatcgggaattggttatattcctagcaattataacctgtttgcatttatc
tgtcattatggccagctcgaaaatggacattatatatctgatgtactttttaataatgaa
tggtgccatattgatgactcaattgttcgaacagtgggcggtattactgacttgagagaa
gatttctcctcttcctacattcttttttataaacgctcaagtctgttggaggagtttgaa
gataagtgtcccaaaatgactttgaaaagaaatgttaaataa

DBGET integrated database retrieval system