KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1A4.01Help
Entry
SPBC1A4.01        CDS       T00076                                 

Gene name
apc10, SPBC1E8.06
Definition
anaphase-promoting complex subunit Apc10
Orthology
K03357  
anaphase-promoting complex subunit 10
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC1A4.01 (apc10)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBC1A4.01 (apc10)
   04113 Meiosis - yeast
    SPBC1A4.01 (apc10)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     SPBC1A4.01 (apc10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1973367..1973533,1973605..1973931,1973990..1974065)
Genome map
AA seq 189 aa AA seqDB search
MAQIRQEALKKQKSETQKSTEGFVDIGNLAQWTCSSEKSGFPIRLVRDDNIDTYWQSDGS
QPHTIHIKFVKRVSIKYVSMYLQYTLDESYTPSTLRISAGTGFQDLEIVTTVQVEEPTGW
VHVPVGDFGRNGLLDVHLIQIKILANHQSGKDSHVRLIKIYAPEIEQPAIAVDEIPYTSL
QFISRNQLR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgacaagaagcattgaaaaaacaaaagtctgagacgcaaaaatcaaca
gaagggttcgttgatattggaaatttggctcaatggacctgctcgagcgaaaaatccgga
tttcctatacgcttggtgcgggatgataatatcgatacatattggcagtctgacggctct
caacctcataccatccatattaaatttgtaaagcgagtatcgattaagtatgtgagtatg
taccttcaatacacccttgatgaatcttatactcccagtactttgcgaatatcagctggg
acagggtttcaagatttggaaattgttacaacagttcaagtcgaggaaccaactggttgg
gtacatgtgccagttggtgattttgggcgaaatggcttgttagatgtgcatttaatacaa
atcaaaatacttgcgaaccatcaaagtggaaaggatagtcatgttcgtttgataaaaata
tatgcgccagaaatagagcagcccgcgatagctgtggatgaaattccctacacaagttta
caattcataagtagaaaccaattacggtaa

DBGET integrated database retrieval system