KEGG   Schizosaccharomyces pombe (fission yeast): SPBC211.07cHelp
Entry
SPBC211.07c       CDS       T00076                                 

Gene name
ubc8
Definition
ubiquitin conjugating enzyme Ubc8 (predicted)
Orthology
K10576  
ubiquitin-conjugating enzyme E2 H [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:spo04120]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(3886012..3886566)
Genome map
AA seq 184 aa AA seqDB search
MSSPRRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYP
WKSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPL
NGEAAALLLREPNTYYAKVRDYIARYANKEDADITLNDSSDDDTMSSIDTESGDEIAGPM
DSDF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcccaaggcgcagaattgagacggacgttatgaagctgctgatgagtgattac
gaggtaactcttgtcaatgataatatgcaagaattttacgttaggttccatggaccgtct
gaaaccccttactcaggtggaatatggaaagttcatgttgaactgccaagtgagtatcct
tggaaatctccaagtattggatttgtaaatcgtatatttcatcccaatatcgatgagctt
agtggaagtgtttgcttggacgtgataaatcaaacttggtctccaatgtttgatatgatt
aatatttttgaggtttttcttccacagctactccgttatcctaatgcgtcggaccctcta
aatggagaggcagcagctctattattgcgagagccgaatacctactatgccaaggttcga
gattatatcgctcggtatgctaataaagaagacgctgatataactttgaacgactcttca
gatgatgacaccatgtcttctattgacactgaatctggcgatgaaattgctggtccaatg
gactctgatttttaa

DBGET integrated database retrieval system