KEGG   Schizosaccharomyces pombe (fission yeast): SPBC211.07cHelp
Entry
SPBC211.07c       CDS       T00076                                 

Gene name
ubc8
Definition
(RefSeq) ubiquitin conjugating enzyme Ubc8 (predicted)
  KO
K10576  
ubiquitin-conjugating enzyme E2 H [EC:2.3.2.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC211.07c (ubc8)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     SPBC211.07c (ubc8)
Ubiquitin system [BR:spo04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   SPBC211.07c (ubc8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(3886012..3886566)
Genome map
AA seq 184 aa AA seqDB search
MSSPRRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYP
WKSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPL
NGEAAALLLREPNTYYAKVRDYIARYANKEDADITLNDSSDDDTMSSIDTESGDEIAGPM
DSDF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcccaaggcgcagaattgagacggacgttatgaagctgctgatgagtgattac
gaggtaactcttgtcaatgataatatgcaagaattttacgttaggttccatggaccgtct
gaaaccccttactcaggtggaatatggaaagttcatgttgaactgccaagtgagtatcct
tggaaatctccaagtattggatttgtaaatcgtatatttcatcccaatatcgatgagctt
agtggaagtgtttgcttggacgtgataaatcaaacttggtctccaatgtttgatatgatt
aatatttttgaggtttttcttccacagctactccgttatcctaatgcgtcggaccctcta
aatggagaggcagcagctctattattgcgagagccgaatacctactatgccaaggttcga
gattatatcgctcggtatgctaataaagaagacgctgatataactttgaacgactcttca
gatgatgacaccatgtcttctattgacactgaatctggcgatgaaattgctggtccaatg
gactctgatttttaa

DBGET integrated database retrieval system